KEGG   Listeria monocytogenes SLCC2540: LMOSLCC2540_0230Help
Entry
LMOSLCC2540_0230  CDS       T02242                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmot  Listeria monocytogenes SLCC2540
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmot00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
230214..231149
Genome map
AA seq 311 aa AA seqDB search
MKIPNSLFDRCGLLPFPHRFFCALKSLNSAIINLGKRCLGLKKWKRDHLGMVMGILNVTP
DSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGISTRPGFSEVTPEEELNRIIPVIKAV
RTKLPDIWISVDTWRAEVAEKAILAGANMINDQWGAKKEPKIAEVAAKYNVPICLMHNRE
NTQYDNFLEDVKKDLLESVAIAKAASVPDEHIILDPGFGFVKTPAQNLEVLRRIDEIVAL
GYEVLLGTSRKSTIGLVLGTTPEDRMEGTGATTVYGFSKGCTITRVHDVLPIARMVRMTD
AITGKLDITKL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcccaaactccctttttgaccgatgcggtttactcccttttccgcatcggttt
ttttgtgcgctaaaatcactgaattctgctataataaatctcggaaagaggtgtttgggc
ttgaagaagtggaaaagggatcacttaggtatggtcatggggatactgaatgttacgcca
gactctttttcggatggcgggaaatatatgcaagtggaagaagctgtggctcgagcgtta
caaatggcagaagatggagcagcaattattgacgttggtggaatatctactcggcctggt
ttttcagaggtaacgcctgaggaagaacttaatcgaattattcctgtcattaaagctgtt
aggacaaaacttccggatatatggatttctgttgatacttggcgtgccgaagtggctgaa
aaagctattttagcaggagctaatatgataaatgatcaatggggtgccaaaaaagaaccg
aaaattgctgaagtagctgcgaaatataacgtgccaatttgtttgatgcacaaccgagaa
aacacgcaatacgataattttctggaagatgtgaagaaagacttattagaaagtgttgca
attgctaaagcggcatccgtgccagatgaacatattattcttgatccgggtttcggtttt
gttaagacacctgcgcagaatttagaagtgttacgacgcattgatgagatagtggcgctt
ggttacgaggttttacttggtacgagtagaaagtcgacaattggtctcgtcttaggaact
actccagaggatagaatggaaggaactggggcgacaaccgtttacggattttcgaaaggt
tgcacaattactcgtgtacacgatgtacttccaattgcgcgcatggtaagaatgacagac
gcgattacgggcaaattagatattacaaaattataa

DBGET integrated database retrieval system