KEGG   Listeria monocytogenes SLCC2540: LMOSLCC2540_0358Help
Entry
LMOSLCC2540_0358  CDS       T02242                                 

Gene name
tpiA-1
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmot  Listeria monocytogenes SLCC2540
Pathway
lmot00010  Glycolysis / Gluconeogenesis
lmot00051  Fructose and mannose metabolism
lmot00562  Inositol phosphate metabolism
lmot01100  Metabolic pathways
lmot01110  Biosynthesis of secondary metabolites
lmot01120  Microbial metabolism in diverse environments
lmot01130  Biosynthesis of antibiotics
lmot01200  Carbon metabolism
lmot01230  Biosynthesis of amino acids
Module
lmot_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmot_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmot00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2540_0358 (tpiA-1)
   00051 Fructose and mannose metabolism
    LMOSLCC2540_0358 (tpiA-1)
   00562 Inositol phosphate metabolism
    LMOSLCC2540_0358 (tpiA-1)
Enzymes [BR:lmot01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOSLCC2540_0358 (tpiA-1)
Exosome [BR:lmot04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOSLCC2540_0358 (tpiA-1)
  Exosomal proteins of bladder cancer cells
   LMOSLCC2540_0358 (tpiA-1)
  Exosomal proteins of melanoma cells
   LMOSLCC2540_0358 (tpiA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBY74999
Position
complement(384393..385157)
Genome map
AA seq 254 aa AA seqDB search
MRKPLVGINMKNYINTRAQTSEWLEATIPLLKNFSDVDTFIFPSMGTLETTANLLAGTSF
GFGPQNMAPEKSGPLTGEFSVESIIDLNANYVEIGHAERKNLFHEKTSEIAKKIKLALDE
KITPVVCVGEEVRANDTNELKNALKKQIEALFQTINLAQWENVVLAYEPEWAIGKASSAE
TNYIESAHQALREIIRELGGDETLVRIIYGGSVSKENAAEIVRQKNVDGLFVGRFGHKPQ
NFADIVSIVSKTKG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacccttagttggaattaatatgaaaaactatattaacactcgggctcagaca
tctgaatggttagaagcgactatccctcttcttaaaaatttttctgatgtggatacgttt
atctttccttctatgggcacactcgaaacgaccgccaaccttttagcggggacatcattt
ggctttggtccacaaaatatggcgccggagaaatccggcccgctaactggtgaattttcg
gtggaatctatcattgacttaaacgcgaactatgtcgaaattggtcacgcagaacgcaaa
aacctttttcatgagaaaactagtgagatagcgaagaagattaaacttgcattggacgaa
aaaatcactccggttgtctgtgtgggtgaagaagtccgtgcgaatgatacaaatgaatta
aaaaatgcgctaaaaaaacaaatcgaagcgctgtttcagacaattaatttagcacagtgg
gaaaatgttgttctggcttatgaaccggagtgggcaattggaaaggcgtcttcagctgag
acaaactacatcgaaagcgcgcatcaagcgctgcgtgaaattattcgcgaactaggcggc
gatgaaacgctcgtaagaattatttacggtggctcggtcagcaaagaaaacgccgcagaa
attgtccgtcaaaaaaatgtcgatggtttattcgtcggaagatttggccataaaccgcaa
aattttgccgacattgtttctattgttagcaaaacgaaaggatga

DBGET integrated database retrieval system