KEGG   Listeria monocytogenes SLCC2540: LMOSLCC2540_0827Help
Entry
LMOSLCC2540_0827  CDS       T02242                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmot  Listeria monocytogenes SLCC2540
Pathway
lmot00010  Glycolysis / Gluconeogenesis
lmot00030  Pentose phosphate pathway
lmot00051  Fructose and mannose metabolism
lmot00680  Methane metabolism
lmot01100  Metabolic pathways
lmot01110  Biosynthesis of secondary metabolites
lmot01120  Microbial metabolism in diverse environments
lmot01130  Biosynthesis of antibiotics
lmot01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmot00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2540_0827 (fbp)
   00030 Pentose phosphate pathway
    LMOSLCC2540_0827 (fbp)
   00051 Fructose and mannose metabolism
    LMOSLCC2540_0827 (fbp)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC2540_0827 (fbp)
Enzymes [BR:lmot01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LMOSLCC2540_0827 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: CBY75468
Position
complement(849725..851686)
Genome map
AA seq 653 aa AA seqDB search
MKTIDMKYLRLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRNG
SGVVKRKIRDIFGAELDDAEINSLSTLIYYPEEKMDLLASETEDLQAWYRTTLFRLIELC
QYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFISA
LSLLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRVC
AANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDPCTYFQPKNEENINYSNAEIT
QIARMHKAISIIQFKLEGEIINRRKEFDMDHRLLLQFIDYKKGTIHLKGKEYLLLDSHFP
TINPEKPYELTDAERELIGKITAAFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIPL
HEDGTFMEMKLRGEKYAGRSLLEQFEILTREAYVRPTGTKEKKYACDIVWYLWTGAISSL
FGKSEMTTFERYFVAEKETHTEEKNPYYKLRNNELICKQILEEFGLDGECGHIINGHTPV
KEGKGESPIKANGKMLVIDGGFAKAYHKETNLAGYTLLFNSYGLQLVSHQPFTTKEDAIK
NETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKLLLDAYRNGLLHENR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaactattgatatgaaatatttacgcttgttagcaaaagaatatcctactattgcc
aagacagctacggaaatcattaatctcgaagcaattatgaaccttccaaaaggaacggaa
cattttttaagtgatgttcacggtgaatatagtgcttttgaacaagtgcttcgtaatggt
tctggtgttgtaaaacggaaaattcgtgatatttttggcgcggagctagatgatgcagag
attaattcacttagtacactgatttattatccagaagaaaagatggatttgcttgctagt
gaaacagaagatttgcaggcttggtatcgcaccacactttttcgtttgattgaactctgc
cagtacgttgcttcaaaatacacacgttctaaagtgagaaaagccatgcccgaagatttt
gcctacatattagaagagttacttcatgaaaactacaatgaagacgacaaaaagctttat
tatgaagaaattttacaacatattatttcacttggtcgtgcagaagaatttattagtgct
ctctcgttacttattcaacaattggtcgtcgatcatttgcacattgttggtgatgtctat
gatcgtggtccttatccagataaaatcatggatacattaatgaattaccattcgctcgat
ttccagtggggtaatcacgatattttatggatgggcgcggctagtggttctagggtttgt
gcggctaatgttattcggatttctgcccgttatttaaatttagatattttagaagatagt
tacggtatttctcttcgccccctggccctttttgccgacgaagtgtacaaagacgatcct
tgtacttacttccagcccaaaaacgaagaaaatattaactatagtaatgcagaaatcacg
caaattgctaggatgcataaggctatctcgattattcagtttaaattggaaggtgaaatt
ataaatcgacgcaaagaatttgatatggatcaccgacttttacttcaatttatcgattat
aaaaaaggcacaattcatctaaagggaaaagaatacctgttgttagacagtcattttcca
acgattaatccagaaaaaccttatgaactcactgacgcggagagagaacttattgggaaa
attactgccgcttttaaaaactgtcgtcgattgcaaaaacatgtacaatttctatattca
aaaggcagcatgtttttaacttataatggtaatttactctaccatggctgcattccactc
cacgaagatgggacttttatggaaatgaaattacgtggcgaaaaatatgctggtcgttcg
cttttagagcagtttgaaatacttacccgcgaagcatacgtacgtccaactggaactaaa
gaaaagaaatatgcatgtgatatcgtttggtatttgtggactggtgccatttcttcgcta
tttggaaaaagtgaaatgactacatttgaacgttattttgttgcagaaaaagaaacacac
acagaagaaaaaaatccttactacaaattgcgtaataacgaattaatttgcaaacaaatt
ttagaagaatttgggcttgatggtgaatgtgggcatatcattaacggccatacgccagtc
aaagaaggaaaaggtgaaagtccgattaaagcgaatggtaaaatgctcgtcatcgatggc
gggttcgcaaaggcctatcataaagaaacgaacttagcgggttatacactactttttaat
agttacggtttacaattagtgagtcatcagccatttactacaaaagaggatgctatcaaa
aatgaaacggatattctttccacgcgtcaagttattgaaatggaaattaaccgtaaacgt
gtaagggataccgatattggggctaaacttagtgagcaggcagaagatttaaaattgtta
ctagatgcctatcgtaatggcttgcttcatgaaaaccgttaa

DBGET integrated database retrieval system