KEGG   Listeria monocytogenes SLCC2540: LMOSLCC2540_0917Help
Entry
LMOSLCC2540_0917  CDS       T02242                                 

Gene name
bglH
Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmot  Listeria monocytogenes SLCC2540
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmot00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
943073..944524
Genome map
AA seq 483 aa AA seqDB search
MFENYQFPKDFLWGGAIAANQAEGAFKVDGKGISLADLHKYHKGKTNDEISEEQHKGVSL
ADIKASMEDKVNYYPKRHGIDFYHTYPEDLALLAEMGFKTFRTSLDWTRIFPTGEETEPN
EAGLKYYDQLIDKIIELGMEPIITILHYETPVEIVLNHGGWHNRKVIDLFEKYGKTVLDR
YNKKVKYWIIINQINLIQFEPFNSTAIPYDAVDDYLSATYQAVHNQFVASAKIYEYGKAL
NPDLMIGTMLADCTAYPFSCDPDDIVLAMKRNRMEYFFADVQFQGEYPQYALNYFDENNI
HIEITEDDKAILQKNTMDYLALSYYYSQMVDSKKNDLDPASITPNPHLKANPWGWAVDPK
GLYNALSQYWDRYHKPIIIAENGFGMYDKLENGEIHDDYRIDYLSAHLKEMKRAMYDGVE
IIAYCAWGPIDIVSCSSAQMEKRYGFIYVDLDNEGNGTGKRIKKDSFSWYKKVIESNGED
LEA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaattatcaatttccaaaagactttttatggggaggagctatcgcagccaac
caagcagaaggcgcatttaaagtagatggaaaaggaattagtttagcagatttgcacaaa
tatcataaagggaaaacaaatgatgaaatcagtgaggaacaacataaaggagtaagtttg
gctgatatcaaagcaagtatggaagacaaagtgaactattatccgaaacgccacggtatc
gacttttatcacacgtatccagaagatttggctttgcttgctgaaatgggctttaaaaca
tttcgaacttcgctggactggacacggatttttccaactggcgaagaaacagaaccaaat
gaagcgggattaaaatattatgaccaattaattgataaaattatcgaacttggcatggag
ccaattattacgattttacattacgaaacgccggtggaaattgtcttaaatcacggcggt
tggcataatcgtaaagttattgatttatttgagaagtacggcaaaacggtacttgatcgc
tacaataaaaaagtaaaatattggattatcattaaccaaattaatttaattcaattcgaa
ccatttaactctactgcgattccatatgatgccgtcgatgattatttatccgctacgtat
caagctgttcataaccaatttgttgcaagtgcgaaaatttacgaatacggaaaagcgcta
aatcctgatttaatgattggtacaatgctcgctgattgcacggcctatccattctcctgc
gatccagatgatatcgtgctcgcaatgaaacgcaaccgcatggaatatttctttgcagac
gtgcagttccaaggcgaatatccacagtatgcgcttaattactttgacgaaaataatatt
catatagaaatcacagaagacgacaaagccattttacaaaaaaacaccatggattattta
gcactttcctattattattcccaaatggtggactccaagaaaaatgatttggacccagct
tcgattacaccaaacccgcatcttaaagctaatccgtggggctgggcagtcgatccgaaa
ggcttgtataacgcattgtcgcagtactgggacagatatcataaaccaattatcattgcc
gaaaatggttttggaatgtatgacaaattagaaaatggcgaaatccatgatgattaccgg
attgattatttatccgcgcatctaaaagaaatgaaacgcgccatgtatgacggcgtagaa
attatcgcatattgcgcttggggaccgattgatatagttagttgctcctccgcacaaatg
gaaaaaagatacggtttcatttacgttgatttagataacgaaggaaacggtacaggcaaa
agaattaaaaaagacagcttttcatggtataaaaaagtaatagagtctaatggggaagac
ttagaagcttaa

DBGET integrated database retrieval system