KEGG   Listeria monocytogenes SLCC2540: LMOSLCC2540_1651Help
Entry
LMOSLCC2540_1651  CDS       T02242                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lmot  Listeria monocytogenes SLCC2540
Pathway
lmot00010  Glycolysis / Gluconeogenesis
lmot00030  Pentose phosphate pathway
lmot00051  Fructose and mannose metabolism
lmot00052  Galactose metabolism
lmot00680  Methane metabolism
lmot01100  Metabolic pathways
lmot01110  Biosynthesis of secondary metabolites
lmot01120  Microbial metabolism in diverse environments
lmot01130  Biosynthesis of antibiotics
lmot01200  Carbon metabolism
lmot01230  Biosynthesis of amino acids
lmot03018  RNA degradation
Module
lmot_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmot00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2540_1651 (pfk)
   00030 Pentose phosphate pathway
    LMOSLCC2540_1651 (pfk)
   00051 Fructose and mannose metabolism
    LMOSLCC2540_1651 (pfk)
   00052 Galactose metabolism
    LMOSLCC2540_1651 (pfk)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC2540_1651 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LMOSLCC2540_1651 (pfk)
Enzymes [BR:lmot01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LMOSLCC2540_1651 (pfk)
Protein phosphatases and associated proteins [BR:lmot01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LMOSLCC2540_1651 (pfk)
Messenger RNA biogenesis [BR:lmot03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LMOSLCC2540_1651 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: CBY76292
Position
complement(1640827..1641786)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgtgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggtgatattcgtaaactagaattaggttctgttggtgattta
cttcaccgcggaggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggccttgtggttatt
ggtggagatggttcttatcacggagcggaagcacttacaaaacgtggattcccaactatt
ggtatcccaggaactattgataatgatatttctggaactgattttactattggttttgat
acagcgttaaacactgttcttgatgcacttgataaaatccgcgatacagctacaagtcat
gaacgtactttcattattgaagttatgggtcgtgacgctggtgatatcgctctttggtct
ggacttgctggtggtgctgaagctatcatcgttccagaagaaagttttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggtaaaaaacatagtattatcgtcgtt
gctgagggcgtaatgtccggtaatgaattcgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccaactgcatttgac
cgtgtacttgcaagccgtcttggtgcacgttcagtagaattattgttagaaaaccgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgaaattttg
aaagaaaaacacacacttgatcaaaaattatttgatctagcatctattttgtcgatttaa

DBGET integrated database retrieval system