KEGG   Listeria monocytogenes SLCC2540: LMOSLCC2540_1708Help
Entry
LMOSLCC2540_1708  CDS       T02242                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lmot  Listeria monocytogenes SLCC2540
Pathway
lmot00260  Glycine, serine and threonine metabolism
lmot00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmot01100  Metabolic pathways
lmot01110  Biosynthesis of secondary metabolites
lmot01130  Biosynthesis of antibiotics
lmot01230  Biosynthesis of amino acids
Module
lmot_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmot00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOSLCC2540_1708 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMOSLCC2540_1708 (trpB)
Enzymes [BR:lmot01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMOSLCC2540_1708 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBY76349
Position
complement(1699962..1701164)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYRASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEGKLPDAIVACVGGGSN
AMGLFYPFVDDVSVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASQMRPEESMVVCLSGRGDKDVNQLKERLEGQTND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggcagatttgta
ccagaaacattaatgaaagcagtgaaagaattagacgaggcgtaccgggcttccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggccgagaaaca
ccactttattttgctgaacaattaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcacataaaatcaataatactattgggcaagcctta
ctcgcacgtcaaatgggcaaacaaaaagtagtggcagaaactggcgcaggacaacacggg
gtggcgactgcaactgttgcagcactttttaatatggaatgtactatttttatgggagaa
gaagatgtgaaacgccaatcactcaatgtgtttagaatggaacttcttggtgcaaaagta
gtgagcgtgaaagcaggaagcagaacattaaaagacgcagtaaatgaggcgctcagattc
tgggttgctaatgtggaagatacacattatattatgggatccgttcttggaccgcatcca
tttccagaaattgttcgtgattaccaaagtgtgataggaatagaagcacgcaaacaacac
ttggaaaaagaaggtaagcttcctgatgcaattgttgcttgtgttggaggcgggagtaat
gcgatggggttattttatccatttgtagatgatgtttctgttcaaatgcacggtgtggaa
gcagcgggacacggtttagaaactgaattccatgcagcgactatttccaaaggagaaatc
gggattttacacggagcgatgatggacgttttacaagatgagaatggacaaattttggaa
gcattttcgatttcagctggcttagattatccaggtattggtccggagcatagctttttc
cgtgatttaggtcgtgcagcgtaccattctgttaccgatgatgaagccgttgaagcattt
caacttttatgtcgtacggaaggaatcattcctgcactcgaaagctcgcacgcgattagt
tatgcagtcaaacttgcaagccaaatgcgtccagaagaaagtatggtcgtttgtttatct
ggtcgcggagataaagatgttaatcaactaaaggaacgcttggagggacaaacaaatgac
taa

DBGET integrated database retrieval system