KEGG   Listeria monocytogenes SLCC2540: LMOSLCC2540_2606Help
Entry
LMOSLCC2540_2606  CDS       T02242                                 

Gene name
pncA
Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
lmot  Listeria monocytogenes SLCC2540
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:lmot00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2667864..2668496)
Genome map
AA seq 210 aa AA seqDB search
MKIAAFDIDAQKGFTPLCPDELPVSGGDKIVPELNFMASLASLRIGSKDAHPQNAVWVVD
SKDEMLAELEYPNADRTWVRHCEPGTKGFELLDGLPVVTDYDYFIWKGMEPDIHPYGACY
HDIVEQLSTGVLEYLREQKVDLVLVGGLAFDFCVKTTVIQLSRAGFSVLVYLPATRALSE
QGFDETKEQLANTEKVQLIETREELVAYCQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgctgcttttgatattgatgcacaaaaaggttttacgccgctttgtcccgat
gaattaccggtttcgggcggagacaaaattgtgccagaacttaattttatggcaagtctt
gcttctcttcgaattggtagtaaggacgcccatccgcaaaatgccgtatgggtagtggat
tccaaagacgaaatgttggctgaactcgaatatccaaatgcagaccgtacttgggtaagg
cactgtgaaccaggtacaaaaggttttgaattattagatggtttaccagttgtgactgat
tatgattactttatttggaaaggtatggagccggatattcatccgtacggcgcttgttac
cacgatattgttgaacagctttcaacaggtgttctagaatatttacgggaacaaaaagtc
gatttagttcttgttggaggtttagcttttgatttttgtgtgaaaactacggttatacag
ttaagtagggcaggcttttctgtattagtttatttaccagcgacacgtgcattatctgaa
caaggttttgatgaaacgaaagagcaattagcaaataccgagaaagtgcaacttatcgaa
acaagggaggaacttgtcgcctattgccagtaa

DBGET integrated database retrieval system