KEGG   Listeria monocytogenes SLCC2540: LMOSLCC2540_2824Help
Entry
LMOSLCC2540_2824  CDS       T02242                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmot  Listeria monocytogenes SLCC2540
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmot00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2540_2824 (bglA)
Enzymes [BR:lmot01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMOSLCC2540_2824 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2889570..2891018)
Genome map
AA seq 482 aa AA seqDB search
MSNTKFPDGFMWGGATAANQFEGGYNSGGKGLACADLFTGGTHTEPRRITAQLEESTFYP
SHEAVDFYHHYKEDIKLMAEAGFKVFRMSINWTRIFPTGKEAEPNEEGLQFYEDVFMELK
KYQIEPLVTIAHFDIPLALTNEVNGWASRDLIDYYLHYCEVIFKHYKHLVKHWLTFNEIN
TATMEIGNYLSLGIRHAEGDFLHQKDDPTVRYQALHHQFVASAKAVKLGHSINPEFMIGC
MIAYMPRYPRTCEPTDVLLAKQTEAMHSHFCGDVHVKGYYPFYAKTFFKDKGIELEFDPE
DEQVLREGTVDFYTFSYYLTLCASNDPAYKNSGKSVIGGAENPYLKTNDWGMQTDPVGLR
IALNDLYTRYNIPLMVVENGLGAFDKLEDDGTINDPYRIDYFKEHILQMHKAIQDGVDLI
GFTIWGCIDLVSASTGEMAKRYGIIYVDKYDDGTGDYSRKKKASYYWYKDVISSNGEIGL
RE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatacgaagtttccagatggctttatgtggggcggggcgaccgcggctaaccag
tttgaaggtggttataattcaggcggaaaagggcttgcctgtgcggatttattcactggt
ggaacgcatacagagccaagaagaattaccgcacaattagaagaatccactttttatcca
agtcatgaagcagtggacttttatcatcattataaagaggatattaagttaatggcagaa
gctggatttaaagtgttccggatgtccataaactggactcgtattttcccgacaggaaag
gaagcagagcctaacgaggaaggattgcagttttatgaagatgtttttatggagctgaaa
aaatatcagattgaaccgttagtgacgattgctcattttgatattccgctagcattaacg
aatgaggtgaacggctgggcgtcgcgtgatttgattgattactatcttcattattgtgaa
gtgatttttaaacactataaacatttagtaaaacactggttgacgttcaatgaaataaat
actgcaacaatggaaattgggaattatttatcgcttggcattcgtcatgcggagggagat
ttccttcatcaaaaagatgacccaacagtgagatatcaagcccttcatcatcaatttgtt
gctagtgcaaaagcggtaaaactaggccatagcatcaacccagaattcatgattggctgt
atgattgcttatatgccacgctacccgcgtacttgcgaaccaactgatgtcttgttggct
aagcaaacggaagcaatgcacagccatttctgcggcgacgttcatgtcaaagggtattat
cctttttatgcaaaaacattctttaaagataagggtattgagcttgaatttgacccagaa
gatgaacaagttttgcgagaaggcacggttgatttttatacttttagctattatttaacg
ctttgtgcatccaacgatcctgcctataaaaattcgggaaaaagtgttattggaggggct
gaaaatccttatttaaaaacaaatgattggggaatgcagacagatcctgtagggcttcgg
attgcactgaatgatttatatactcgctataatattccgcttatggtagttgaaaatggt
ttaggagcctttgataaattggaagacgatgggacgattaatgatccgtatcgaattgat
tatttcaaagaacatattcttcaaatgcataaagcaattcaagatggtgtagatttgatt
ggatttactatttggggttgtattgacctagtgagcgcatctacaggggaaatggccaaa
cgttatggtattatttatgtggataaatacgatgatggaaccggtgattattcgcgtaaa
aagaaagcatcctattattggtataaagatgtgattagttcaaatggtgaaattggattg
agagagtaa

DBGET integrated database retrieval system