KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_0190Help
Entry
LMOSLCC2479_0190  CDS       T02241                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
lmoy00900  Terpenoid backbone biosynthesis
lmoy01100  Metabolic pathways
lmoy01110  Biosynthesis of secondary metabolites
lmoy01130  Biosynthesis of antibiotics
Module
lmoy_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOSLCC2479_0190 (ispE)
Enzymes [BR:lmoy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LMOSLCC2479_0190 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CBY56461
Position
193956..194837
Genome map
AA seq 293 aa AA seqDB search
MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSSDAAAALKGLNVIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPGCWIVLAKPSISVSTPTI
YKELQVDNVEHPDTQKMIESIKNGDLDGIFAATGNVLESVTLEKNPQVKRIKDRMLAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSEGENDTNINY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcattacagcaccagctaaaattaatctttcacttgatgcgctgtacaaa
cgtgaggatggctatcatgaagtggaaatggtgatgacaacaatcgaccttgctgataga
ttatacttagaacgcttagacgaagacaaaattgtgctggatgtaaaagcgcactttatt
ccagaagatcgtcgcaatttaatttatcaagcggccctccttttaaagaagcgttttgac
gtaaagatgggtgtgcgcattacaattgataagcatattcctgtttctgcgggacttgct
ggtggtagttcagatgcagctgcagcgctcaaaggattaaatgtcatttgggaacttggt
ctttcaatagaagaattagccgaaattagttcagaaattggttctgatatcgctttttgc
gtatacggcggaacagcgctagcaactggacgcggggagaaaatttctgcgttacctaat
attcctggttgttggattgtacttgctaagccgagcattagcgtgtcaacacccactatc
tataaagaacttcaagtagacaatgtagaacacccagacacacaaaaaatgattgaatcc
atcaaaaatggtgatctagacgggatttttgcggctacagggaatgtgctagagtctgtg
acattagaaaaaaatccgcaagttaaacgaataaaagatcggatgttagcgtttggtgct
gaggcggctctaatgagtggtagcggtccgacagtgtttgcgcttatcaaacagtactcc
agagcaaaacgtgtctataacggcttgcgtggcttttgtgaggaagtttatatggttaga
ccatggagtgaaggcgagaacgatacaaatataaattattaa

DBGET integrated database retrieval system