KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_0225Help
Entry
LMOSLCC2479_0225  CDS       T02241                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmoy00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
232627..233442
Genome map
AA seq 271 aa AA seqDB search
MKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGISTRPG
FSEVTPDEELARIIPVIKAVRTKLPDIWISVDSWRAEVAEQAILAGADMINDQWGAKKEP
KIAEVAAKYDVPICLMHNRENAQYDNFLEDVKKDLLESIAIAKAASVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPGDRMEGTGATTVYGFSKG
CTITRVHDVLPIARMVRMTDAITGKLDITNL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagtggaaaagggatcacctaggtatggtcatggggatattgaatgttacgcca
gattctttttcagatggcgggaaatatatgcaagtagaagaagcggtggctcgagcgtta
caaatggcggaagatggagcagcgattattgacgttggaggaatatctactcgtcctggt
ttttcggaagtaacccccgatgaagaacttgcccgaattataccggtcattaaagctgtc
aggacgaaattacccgatatatggatttccgttgattcttggcgtgctgaagtagcggaa
caggctatcttagcgggagctgatatgataaatgaccagtggggtgcgaaaaaagaaccg
aaaattgccgaagttgctgcaaaatacgatgtaccgatttgtttaatgcacaatcgtgag
aacgcgcaatacgacaattttttagaagatgtgaaaaaagacttgttagaaagtattgcc
atagctaaagcagcatcagtaccagacgagcatattattctcgatccaggttttggtttt
gttaagacacctgctcagaatttagaagtgttacgacggattgatgagatagtcgcactt
ggttacgaggttttactcggtacgagcaggaagtcaactattgggcttgtcctaggaact
actcctggagatagaatggaaggaactggagcaacaactgtctatggattttcgaaaggt
tgtacaattactcgtgtccatgatgtacttccaattgcacgtatggtgcgaatgacagat
gcaatcactggcaaattagatattacaaatttataa

DBGET integrated database retrieval system