KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_0225Help
Entry
LMOSLCC2479_0225  CDS       T02241                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LMOSLCC2479_0225 (folP)
Enzymes [BR:lmoy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LMOSLCC2479_0225 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
232627..233442
Genome map
AA seq 271 aa AA seqDB search
MKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGISTRPG
FSEVTPDEELARIIPVIKAVRTKLPDIWISVDSWRAEVAEQAILAGADMINDQWGAKKEP
KIAEVAAKYDVPICLMHNRENAQYDNFLEDVKKDLLESIAIAKAASVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPGDRMEGTGATTVYGFSKG
CTITRVHDVLPIARMVRMTDAITGKLDITNL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagtggaaaagggatcacctaggtatggtcatggggatattgaatgttacgcca
gattctttttcagatggcgggaaatatatgcaagtagaagaagcggtggctcgagcgtta
caaatggcggaagatggagcagcgattattgacgttggaggaatatctactcgtcctggt
ttttcggaagtaacccccgatgaagaacttgcccgaattataccggtcattaaagctgtc
aggacgaaattacccgatatatggatttccgttgattcttggcgtgctgaagtagcggaa
caggctatcttagcgggagctgatatgataaatgaccagtggggtgcgaaaaaagaaccg
aaaattgccgaagttgctgcaaaatacgatgtaccgatttgtttaatgcacaatcgtgag
aacgcgcaatacgacaattttttagaagatgtgaaaaaagacttgttagaaagtattgcc
atagctaaagcagcatcagtaccagacgagcatattattctcgatccaggttttggtttt
gttaagacacctgctcagaatttagaagtgttacgacggattgatgagatagtcgcactt
ggttacgaggttttactcggtacgagcaggaagtcaactattgggcttgtcctaggaact
actcctggagatagaatggaaggaactggagcaacaactgtctatggattttcgaaaggt
tgtacaattactcgtgtccatgatgtacttccaattgcacgtatggtgcgaatgacagat
gcaatcactggcaaattagatattacaaatttataa

DBGET integrated database retrieval system