KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_0929Help
Entry
LMOSLCC2479_0929  CDS       T02241                                 

Gene name
bglH
Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmoy00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
950974..952425
Genome map
AA seq 483 aa AA seqDB search
MFENYQFPKDFLWGGAIAANQAEGAFKVDGKGISLADLHKYHKGKTNDEISEEQHKGVSL
ADIKASIEDKINYYPKRHGIDFYHTYPEDLELLAEMGFKTFRTSLDWTRIFPTGEETEPN
EAGLKYYDQLIDKIIELGMEPIITILHYETPVEIVLNHGGWHNRKVIDLFEKYGKTVLDR
YNKKVKYWIVINQINLIQFEPFNSTAIPYDAVDDYLSATYQAVHNQFVASAKIYEYGKAL
NPDLMIGTMLADCTAYPFSCDPDDIVLAMKRNRMEYFFADVQFQGEYPQYALNYFEENNI
HIEITEEDKAILQKNTMDYLALSYYYSQMVDSKRNDLDPASITPNPHLKANPWGWAVDPK
GLYNALSQYWDRYHKPIIIAENGFGMYDKLENGEIHDDYRIDYLSAHLKEMKRAMYGGVE
IIAYCAWGPIDIVSCSSAQMEKRYGFIYVDLDNEGNGTGKRIKKDSFSWYKKVIESNGED
LEA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaattatcaatttccgaaagacttcttatggggtggggccatcgcagccaac
caagcagaaggcgcatttaaagtagatggaaaaggaattagtttagcagatttgcacaaa
tatcataaaggtaaaacaaatgatgagattagcgaggaacagcataaaggagtaagttta
gctgatatcaaagcaagtatagaggataaaataaactattatccgaaacgccacggtatc
gatttttatcacacgtatccagaagacttggagttgcttgctgaaatgggttttaaaaca
ttccgaacttcactggactggacacggatttttccaactggcgaagaaactgaaccaaat
gaagcgggattaaaatattatgaccaattaatcgataaaattatcgaacttggcatggag
ccaattattacgattttacattacgaaactcccgtggaaattgttttaaatcatggcggg
tggcacaatcgtaaagtcattgatttatttgagaagtacggcaaaacagtacttgatcgc
tacaataaaaaagtaaaatattggattgtcattaaccaaattaatttaattcaattcgaa
ccatttaactctactgcgattccatacgatgcagttgatgattatttatccgcaacatat
caagcagttcacaatcaatttgtcgcaagtgcaaaaatttatgaatacggaaaggcactg
aaccctgatttaatgattggtacaatgctagctgattgtacggcctatccattctcatgc
gatccggatgatatcgtcctcgcaatgaaacgtaatcgtatggaatatttcttcgcagat
gtgcagttccaaggcgaatatccacaatatgcgcttaactacttcgaagaaaataatatt
catattgaaattacagaagaagacaaagctattttgcaaaaaaataccatggattatcta
gcgctttcctattattattcacaaatggtagattccaaaagaaatgatttggacccagct
tcgattacaccaaacccgcatcttaaagctaatccgtggggctgggcagtcgatccaaaa
gggctatataatgctctgtcacaatactgggatagataccataaaccaattattattgct
gaaaatggtttcggcatgtatgacaaattggaaaatggcgaaatccacgatgattaccga
atcgattatttatccgcccatctaaaagaaatgaaacgtgctatgtatggtggcgtagaa
ataatcgcatattgcgcttggggaccgattgatatcgtcagctgttcttccgcacaaatg
gaaaaaagatacggtttcatttacgttgatttagataacgaaggaaacggcacaggcaaa
agaattaaaaaagacagcttttcatggtataaaaaagtaatagagtctaatggggaagac
ttagaagcttaa

DBGET integrated database retrieval system