KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_0996Help
Entry
LMOSLCC2479_0996  CDS       T02241                                 

Gene name
bsaA
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lmoy00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lmoy00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1013088..1013567
Genome map
AA seq 159 aa AA seqDB search
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGDNFEILG
FPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEW
NFAKFLIDENGEVIERFPSKMKPEDFEDKVEALVAKVNN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccatgatttttctgaaaaagcaatgaacggcaaagaaatagctttaagtgat
tataaaggtaaagttttactcatagtgaataccgcgagtaaatgtggcttaacacctcaa
ttagaaggtcttgaagcaatgtataaaaaattgggtggagataattttgaaattctcggt
ttcccatgtaaccagtttttacgtcaagaccctggtagtgatgaggaaattttagaattt
tgccaaatgaattatggtgtgactttccaaatgttttccaaaattaaagtaaaaggcaaa
gatgccagcccactttataaatatttaaccgaacaaactggtggtaaaaaagtagaatgg
aactttgcgaaatttttaattgatgaaaatggagaagttattgaacgtttcccatctaaa
atgaaacctgaagattttgaggataaagtggaagcacttgttgcgaaagtaaataattaa

DBGET integrated database retrieval system