KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_1067Help
Entry
LMOSLCC2479_1067  CDS       T02241                                 

Gene name
pdhC
Definition
pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:lmoy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmoy00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lmoy00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lmoy00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1079731..1081365
Genome map
AA seq 544 aa AA seqDB search
MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSVEEITSPVSGTIKEIK
VAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAPAQASGKGIFEFKLPDI
GEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVDGTVKDILVSEGTVATVG
QVLVTFEGDFEGEASHESTPESPAEDAALANNDATSAPATGGNGTPSSKKDPNGLVIAMP
SVRKYAREKGVNIAEVAGSGKNNRVVKADIDAFLNGEQPAAATTTAQTEEKAAAPKAEKA
AGKQPVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHVTLMDEIEVTALMAHRKRFKE
VAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEELVYKHYFNVGIAADTDHGLYV
PVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHGSATISNIGSAGGQWFTPVINYP
EVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRVIDGATAQKAMNNIKRLLNDPELL
LMEV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcatttaaattaccggatatcggtgaaggtatccatgaaggtgaaatcgtt
aaatggtttgtacaaccaggcgataaaattgaagaagatgaatccctatttgaagtacaa
aacgacaaatcagtggaagaaatcacttctccagtttcaggaacaattaaagaaatcaaa
gttgctgaaggtacagttgctacagttggacaagtactagtaacgtttgatggcgtagaa
ggtcacgaagacgacgccgaagaagaaagcgcagcaccaaaagcagaatccacagaatca
actcctgcacccgcacaagctagcggaaaaggaatttttgaattcaaattaccagatatt
ggtgaaggaattcatgaaggtgaaattgttaaatggtttattcaaccgggcgataaagta
gaagaagatcagtccatttttgaagtacaaaacgacaaatctgtcgaagaaattacttct
ccagtagatggtactgttaaagatattttagttagcgaaggaacagtagcaacagttggt
caagtattagtaacattcgaaggtgattttgaaggagaagcaagccatgaatctactcca
gaatctccagcagaagacgctgcacttgctaacaacgatgcaacttccgcaccagcaaca
ggtggaaacggaactccatcatctaaaaaagatcctaatggccttgtaattgcaatgcct
tctgtacgtaaatatgcgcgtgaaaaaggcgttaatatcgctgaagtagcaggctctgga
aaaaataaccgcgtagttaaagctgatattgatgctttcctaaacggcgaacaaccagct
gcagcaacaactactgctcaaacagaagaaaaagcagctgcaccaaaagcagaaaaagca
gcaggaaaacaaccagttgcaagctccgatgcttacccagaaacacgcgaaaaattaaca
ccaactcgtcgtgcgattgcaaaagcaatggtaaactcaaaacatacagctccacacgtt
actttaatggacgaaatcgaagtaactgcacttatggctcaccgcaaacgtttcaaagaa
gtggctgccgaaaaaggtatcaaacttactttcttaccttacatggtgaaagctcttgtt
gcaacgcttcgtgacttcccagtgcttaacacaactttagatgatgcgacagaagaactt
gtttacaaacattacttcaacgttggtatcgcagcagatacagaccacggtttatatgta
ccagtaattaaaaatgctgacaaaaaatccgtattccaaatttctgatgaaatcaacgaa
ctagctggaaaagcacgtgatggtaaattaactgctgacgaaatgcgccacggttccgca
actatttctaatatcggttctgccggcggacaatggttcactccagtaattaattaccca
gaagttgctattctaggtgttggtcgtattgctcaaaaacctatcgtaaaagatggcgaa
attgtagcagcaccagtactagctctttccttgagctttgaccaccgtgtaattgacggc
gcaactgctcaaaaagcaatgaacaatattaaacgtttattaaacgatccagaattatta
ctaatggaggtgtaa

DBGET integrated database retrieval system