KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_1091Help
Entry
LMOSLCC2479_1091  CDS       T02241                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
lmoy00040  Pentose and glucuronate interconversions
lmoy00052  Galactose metabolism
lmoy00500  Starch and sucrose metabolism
lmoy00520  Amino sugar and nucleotide sugar metabolism
lmoy01100  Metabolic pathways
lmoy01130  Biosynthesis of antibiotics
Module
lmoy_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LMOSLCC2479_1091 (galU)
   00052 Galactose metabolism
    LMOSLCC2479_1091 (galU)
   00500 Starch and sucrose metabolism
    LMOSLCC2479_1091 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LMOSLCC2479_1091 (galU)
Enzymes [BR:lmoy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LMOSLCC2479_1091 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD Smr
Motif
Other DBs
NCBI-ProteinID: CBY57362
Position
complement(1108253..1109125)
Genome map
AA seq 290 aa AA seqDB search
MKVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQFIVEEAVASGIEDILIVTGKGK
RAIEDHFDSVPELENNLREKNKLDLLHLVEETTNINLHFIRQSKPKGLGDAILQAKGFIG
NEPFVVMLGDDIVQSKTPCAKQLIDQYEKTHSSVIGVQNVPREETYRYGIIDPDKEVSDR
LYNVTGFVEKPNVEDAPSNLAILGRYLLTPEIFKYLETQEAGSGGEIQLTDAINRLNEIQ
PVFAYDFEGERFDVGDKFGFIETTLKFALKHPEIKDDVRDLIIRLGDELK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaagcagtcatcccggcagcaggacttggtacaagatttcttcctgca
acaaaagcgatgccaaaagaaatacttccaattgtagacaaaccaacgattcaatttatc
gttgaagaagcagttgcgtctggaattgaagatattctaattgttacagggaaaggaaaa
agagccatagaagaccatttcgactctgtacctgaacttgaaaataatttacgtgaaaaa
aacaaattagatttattacatttagtggaagaaaccactaatattaacttacattttatt
cgtcagtcaaaacctaagggacttggagacgcaattttacaagctaaaggtttcattggt
aacgaaccatttgtagtaatgcttggggatgacatcgttcaatctaaaaccccttgtgct
aaacaattaatcgatcaatacgaaaagactcatagttctgttatcggtgtacaaaatgtt
cctcgcgaagaaacatatcgttacggcattattgatcctgacaaagaagtaagtgatcgt
ttgtataatgtaactggttttgttgaaaagcctaatgtagaagatgctccttccaactta
gcgattttaggaagatatttattaactccagaaatttttaagtatctagaaacacaagaa
gctggttctggtggagaaattcaattaactgatgcaattaaccgtttaaatgaaattcaa
cctgttttcgcctatgattttgaaggagaacgttttgatgttggtgataaattcggcttt
attgaaactactttaaaatttgcgctaaaacatcccgaaattaaagacgatgtccgcgac
ctaattatccgtctcggcgatgaacttaaataa

DBGET integrated database retrieval system