KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_1377Help
Entry
LMOSLCC2479_1377  CDS       T02241                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
lmoy00900  Terpenoid backbone biosynthesis
lmoy01100  Metabolic pathways
lmoy01110  Biosynthesis of secondary metabolites
lmoy01130  Biosynthesis of antibiotics
Module
lmoy_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOSLCC2479_1377 (dxr)
Enzymes [BR:lmoy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     LMOSLCC2479_1377 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: CBY57648
Position
1362724..1363866
Genome map
AA seq 380 aa AA seqDB search
MKKIILLGATGSIGTQTLAIIRENPEKFQVVALSFGRNMERGRAIIKEFKPKMVAVWHTR
DRVTLEAEFPNVKFFNGLEGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIAN
KETLVTAGHLVMRAAKEKNISLLPVDSEHSAILQALNGENTERIEKIILTASGGSFRDKT
REQLSAVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRES
IIHSMVQFVDGSFIAQLGTPDMRMPIQYALTYPDRLYIPYEKEFRITDFSALHFEKVDYE
RFPALKLAYNAGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISNP
DLDTILQVDQETRAYVKTLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattttgctaggtgcaactggttcaattggaacacaaacgcttgcaatc
attcgcgaaaatcctgaaaaatttcaagttgttgcgcttagttttgggcgtaatatggaa
cgtggtagggcgattataaaagagtttaaaccaaaaatggtcgctgtttggcatacgaga
gatcgtgttaccttagaagcagaattcccaaatgtgaaattttttaatggtttagaagga
cttagagaagtagcgacctatttagatggggacgttcttttaaatgcagttatggggagc
gttggactacttcctacattagatgcaatcgaagctgggaaggccattgcaatagctaat
aaagaaacacttgtcacggctggacatttagttatgcgtgcggcgaaagaaaagaacatt
tctctattacccgttgatagtgaacattctgctattttacaagcattaaacggagaaaat
acggaaagaatcgaaaaaataattttgacagcgagcggtggaagtttccgagataagacg
agggagcaactcagcgcggttacggtgaaagaagcgttaaagcatccgaactggaatatg
gggaataaattaacaattgattcagcaacgatgtttaacaaaggtttggaagtgatggag
gcgcactggctgtttggtgtagattacgatgatattgaggtagttatccagcgcgaaagt
attatccattctatggttcagttcgtggatggaagtttcatcgcacaacttggaacgcca
gatatgcggatgccaattcaatatgctttaacctatcccgacagactctatataccgtat
gaaaaagaattccggatcactgatttttccgcacttcattttgaaaaagtggattatgaa
agatttccggcattgaaactcgcgtataatgctggtaaaataggtggaacaatgccgaca
gttttgaatgcggcaaatgaaattgctgttgctggctttttaaatggacaggtagctttt
tataatattgaagcacttgttgagaatgcaatgaatcgtcatactagcatttctaatcct
gacttggatacgattttacaagtcgatcaagaaacacgcgcgtatgtaaagacactttta
tag

DBGET integrated database retrieval system