KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_1474Help
Entry
LMOSLCC2479_1474  CDS       T02241                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
lmoy00071  Fatty acid degradation
lmoy00072  Synthesis and degradation of ketone bodies
lmoy00280  Valine, leucine and isoleucine degradation
lmoy00310  Lysine degradation
lmoy00362  Benzoate degradation
lmoy00380  Tryptophan metabolism
lmoy00620  Pyruvate metabolism
lmoy00630  Glyoxylate and dicarboxylate metabolism
lmoy00640  Propanoate metabolism
lmoy00650  Butanoate metabolism
lmoy00900  Terpenoid backbone biosynthesis
lmoy01100  Metabolic pathways
lmoy01110  Biosynthesis of secondary metabolites
lmoy01120  Microbial metabolism in diverse environments
lmoy01130  Biosynthesis of antibiotics
lmoy01200  Carbon metabolism
lmoy01212  Fatty acid metabolism
lmoy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMOSLCC2479_1474
   00630 Glyoxylate and dicarboxylate metabolism
    LMOSLCC2479_1474
   00640 Propanoate metabolism
    LMOSLCC2479_1474
   00650 Butanoate metabolism
    LMOSLCC2479_1474
  Lipid metabolism
   00071 Fatty acid degradation
    LMOSLCC2479_1474
   00072 Synthesis and degradation of ketone bodies
    LMOSLCC2479_1474
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMOSLCC2479_1474
   00310 Lysine degradation
    LMOSLCC2479_1474
   00380 Tryptophan metabolism
    LMOSLCC2479_1474
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMOSLCC2479_1474
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMOSLCC2479_1474
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LMOSLCC2479_1474
Enzymes [BR:lmoy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMOSLCC2479_1474
Exosome [BR:lmoy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMOSLCC2479_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBY57745
Position
complement(1463915..1465084)
Genome map
AA seq 389 aa AA seqDB search
MKEVVIIDAVRTPIGKFGGSLKDISAVDLGATALKGVLERANIAPERVDQVIFGNVLQAG
LGQNVARQIAIKAGIPYKVPGVTINEVCGSGLKSVMLGRQAIQLGEADIVAVGGTENMSQ
APLLLNPELAGEEINPKKLRNSMLIDGLTDVYGEYHMGITAENVAEKFSVTREEQDEFAH
NSQMKAASAQEKKLFEEEIIPVKLPDGSFFEADETIRANSTLEKLATLKSVFKEGGTVTA
GNASGINDGASAIILMSKEKAVAENIPYIATIKVTSEVGVDPALMGYAPYYAVNEALTKG
GYSIDEIDLFHLNEAFASQSVAVARDLKIPEEKLNIYGGAIALGHPIGASGARIIASLLN
ELKHENKHIGVASLCVGGGIGIAIILERA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttataatagatgcagttagaacaccaattggaaaattcggtggtagt
ttgaaagacatcagtgcagtagatcttggtgctaccgctctaaaaggtgttttagaaaga
gccaatattgctccagaacgtgtggatcaagtaatttttggtaatgtattacaagctgga
cttggccaaaatgtagctagacaaatcgctattaaagcaggaattccttataaagtaccc
ggagtcacaatcaatgaagtgtgtggatctggcttaaaatcggttatgcttggcagacaa
gcaattcaactaggggaagctgacatcgtagcagtaggagggaccgaaaatatgtcccaa
gcaccacttttacttaatcccgagctagccggtgaagaaatcaatccaaaaaaactaaga
aatagcatgttaattgatggtttaacagatgtttacggcgaatatcacatgggaattact
gcagaaaatgttgcggaaaaattctccgtaacccgagaagaacaagatgaatttgctcat
aactctcaaatgaaggccgcaagtgcacaagaaaaaaaactttttgaagaagaaattatt
cctgtaaaacttccagacggttcattttttgaagccgatgaaacgattcgcgcgaattca
actctagaaaaattagctacgttgaaaagcgtattcaaagaaggtggaactgttacagcc
ggtaatgcttccggtatcaatgatggagcttccgcaattattttaatgtcgaaagaaaag
gcagtcgcggaaaacattccttatatcgcaacaatcaaagtaacctctgaggttggtgtc
gatccagcacttatgggttacgcgccatactatgcagtaaatgaagctttaactaaaggt
ggatattctatcgatgaaattgatttattccatttaaacgaagcttttgcatcgcagtct
gttgcagtggctcgtgatttgaaaattcccgaagagaaacttaatatttacggtggagca
attgcgctaggtcatccaatcggagcttccggcgcacgcattattgcctctttgttaaat
gaattaaaacatgaaaacaagcatatcggggtagcttccttgtgcgttggtggtggtatt
ggcattgcaattatccttgaaagagcatga

DBGET integrated database retrieval system