KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_1683Help
Entry
LMOSLCC2479_1683  CDS       T02241                                 

Gene name
pepV
Definition
dipeptidase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMOSLCC2479_1683 (pepV)
  Amino acid metabolism
   00300 Lysine biosynthesis
    LMOSLCC2479_1683 (pepV)
Enzymes [BR:lmoy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LMOSLCC2479_1683 (pepV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1682612..1684024)
Genome map
AA seq 470 aa AA seqDB search
MTEINWQKEVEARKDDFLEDLKGLLRIPSVRDDSKKTEDAPFGPDVKRALDYMMELGKKD
GFTAKEVGNVAGHLEYGQGEELVGVLGHVDVVPVGDGWTNGPFEPTLRDGKLYARGVADD
KGPTIAGYYALKIIKELGLPLSRRVRIIIGSDEESGMSCVERYFETEEQPTLGFVPDAEF
PIIHAEKGISELDVSFKDGEAGGEAAFRLLSVESGERYNMVPDHATAILEDVKDFDKVAS
AFKTFLANHPVEGTLEENGKSVKINIVGKSAHAMEPNNGVNAGLHLVAFLGKFKLTGAAN
DFVTFGRDYLFGDSRAVKLGISYEDAESGELTMNVGVIRYDVAEGGKYGLNFRYPVTASM
DKLKNKMQTVVYEYNAQYTHYEDSKPLFVPKDHPLIQVLQEVYTKQTGEEATLLAIGGGT
YARHMETGVAFGALFPGREDTMHQKDEFSYFDDLLKATAIYAEALYKLAK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaattaattggcaaaaagaagtggaagcacgcaaagatgatttcctagaagat
ttaaaagggcttcttcgcattccaagtgttcgcgatgacagtaaaaaaacagaagatgcg
ccgtttggaccggacgtaaaacgcgcactcgattatatgatggagcttggtaaaaaagac
ggcttcacagcgaaagaagttggaaacgtagcgggacaccttgaatacggccaaggcgag
gagctagttggcgttttagggcatgtggatgtagtgccagttggtgacggctggacaaac
ggaccattcgaaccaactttacgcgacggtaaattatatgctcgtggagttgcggacgat
aaaggcccaacaatcgctggttactatgcactaaaaattattaaagaactaggattacca
ctttctcgccgagttagaattattattggttctgatgaggaaagcggtatgagttgtgtg
gagcgttattttgaaacagaagagcaaccaacgcttggttttgttcctgatgcagaattt
ccaatcattcacgcggaaaaaggtatctcagaactagatgtatcatttaaagacggtgaa
gcaggcggggaagcagcattccgtttacttagcgtagaatcaggcgaacgctacaacatg
gttccagatcacgcaacagctattttagaagatgtaaaagactttgataaagtagcgagt
gccttcaaaaccttcctagcaaatcatccagtagaaggaacactagaagaaaatggcaag
tccgttaaaattaatattgtcggcaaatctgcccatgcaatggaaccaaataacggtgtg
aacgctggtctacatttagtcgctttccttggtaaattcaagctgactggagcagcgaat
gatttcgtaacatttggtcgtgactatctgtttggtgattctcgtgctgttaaactaggc
attagctatgaagatgcagaaagcggcgaactaacaatgaacgttggagttatccgttat
gatgttgcagaaggtggcaaatatggacttaatttccgttatccagttactgctagcatg
gacaaacttaaaaataaaatgcaaacagtcgtatatgagtataatgcgcaatatacacat
tatgaagattccaaaccacttttcgtaccaaaagatcacccacttattcaagttttacaa
gaagtatatacaaaacaaacaggtgaagaggctactttactagcaataggtggcggaact
tatgcacgtcatatggagactggcgtagcgttcggagcgctattcccaggccgtgaagac
acgatgcaccaaaaagacgaattcagctattttgatgatttgttaaaagctacagcaatt
tacgcagaagcgctttacaaattagcgaagtaa

DBGET integrated database retrieval system