KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_1691Help
Entry
LMOSLCC2479_1691  CDS       T02241                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LMOSLCC2479_1691 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LMOSLCC2479_1691 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMOSLCC2479_1691 (trpB)
Enzymes [BR:lmoy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LMOSLCC2479_1691 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1690843..1692045)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYQASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMKCTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEGKLPDAIVACVGGGSN
AMGLFYPFVDDASVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASKMRPEESMVVCLSGRGDKDVNQLKERLEGQTND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggtagatttgta
ccagaaacattaatgaaagcagtgaaagaattagatgaggcgtaccaagcttccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggccgagaaaca
ccactttattttgccgaacaactaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcacataaaatcaacaatactattggtcaagcctta
ctcgcacgtcaaatgggcaaacaaaaagtagtggcagaaactggtgcgggtcaacacggc
gtggcaacagcaactgttgcagcactttttaatatgaaatgtactatttttatgggagaa
gaagatgtaaaacgtcaatcactcaatgtatttagaatggaacttcttggtgcaaaagta
gtgagcgtgaaagcaggaagcagaacattaaaagatgcagtaaatgaagcgcttaggttc
tgggttgcaaatgtggaagatacgcattacattatgggatctgttcttggaccacaccca
tttccagaaatcgttcgtgattaccaaagtgtaataggaatagaagcacgcaaacaacac
ttggaaaaagaaggtaagcttcctgatgcaattgtagcttgtgttggaggcgggagtaat
gcgatgggcttattttatccatttgtagacgatgcttctgttcaaatgcacggtgtggaa
gcagctggtcacggattagagacagaattccacgcagcaaccatttccaaaggagaaatt
gggattttacacggagcgatgatggatgtattacaagatgagaatgggcaaattttggaa
gcattttcgatttctgctggcttagattatccgggtattggtccagagcatagctttttc
cgtgatttaggtcgcgcagcgtatcattctgttactgatgatgaagcagtcgaagccttt
caacttttatgtcgtacggaaggaattattccagcgctcgaaagttctcacgcaattagc
tatgcggttaaacttgcaagtaaaatgcgtccagaagaaagtatggttgtttgtttatct
ggtcgcggagacaaagacgttaaccaactaaaagaacgtttggagggacaaacaaatgac
taa

DBGET integrated database retrieval system