KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_2518Help
Entry
LMOSLCC2479_2518  CDS       T02241                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
lmoy00010  Glycolysis / Gluconeogenesis
lmoy00051  Fructose and mannose metabolism
lmoy00562  Inositol phosphate metabolism
lmoy01100  Metabolic pathways
lmoy01110  Biosynthesis of secondary metabolites
lmoy01120  Microbial metabolism in diverse environments
lmoy01130  Biosynthesis of antibiotics
lmoy01200  Carbon metabolism
lmoy01230  Biosynthesis of amino acids
Module
lmoy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lmoy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2479_2518 (tpi)
   00051 Fructose and mannose metabolism
    LMOSLCC2479_2518 (tpi)
   00562 Inositol phosphate metabolism
    LMOSLCC2479_2518 (tpi)
Enzymes [BR:lmoy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LMOSLCC2479_2518 (tpi)
Exosome [BR:lmoy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LMOSLCC2479_2518 (tpi)
  Exosomal proteins of bladder cancer cells
   LMOSLCC2479_2518 (tpi)
  Exosomal proteins of melanoma cells
   LMOSLCC2479_2518 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBY58789
Position
complement(2546322..2547077)
Genome map
AA seq 251 aa AA seqDB search
MRKPIIAGNWKMNKTAAKAGQFAEDVKNNVPSSDAVESVVAAPALFLQELVRLTEGTDLR
VSAQNCYFEDEGAFTGEISPFALADLGVSYVIIGHSERREYFHETDEDINKKAHAIFKHG
MTPIICCGETLDQREAGQTDTWVRGQIRAALAGLTEEQVIKSVIAYEPIWAIGTGKSSTS
ADANETCAVIRAEVADAVSQKAADAVRIQYGGSVKPENIADYLAESDIDGALVGGASLEP
ASFLALLEAVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgctggtaactggaaaatgaacaaaactgctgcaaaagcagga
caatttgcagaagacgtaaaaaataacgtgccatcaagcgatgctgttgaatcagtagtt
gctgcaccggctctatttttacaagaattagttcgtcttactgaaggaactgatcttcgt
gtatctgcacaaaactgttattttgaagacgaaggtgctttcactggcgaaattagcccg
tttgcacttgctgatttaggtgtttcttatgttattatcggacactctgaacgtcgtgag
tacttccacgaaacagacgaagatattaacaaaaaagcacatgcaatcttcaaacacggc
atgacaccaatcatttgctgtggtgaaacattagatcaacgtgaagctggtcaaacagat
acttgggtacgtggtcaaatccgtgcagctcttgctggattaacggaagaacaagtaatc
aaatctgttattgcttatgaaccaatttgggcaatcggtactgggaaatcttctacaagt
gctgatgcaaacgaaacttgtgcagttattcgtgcagaagttgctgacgctgtatctcaa
aaagcagcagacgcagttcgtattcaatacggcggtagcgtaaaacctgaaaacattgct
gattatcttgcagagtccgacattgacggcgctcttgtaggtggagcaagcttagaacca
gcatcgttcttagcattattggaggcagtaaaataa

DBGET integrated database retrieval system