KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_2798Help
Entry
LMOSLCC2479_2798  CDS       T02241                                 

Gene name
acsA
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LMOSLCC2479_2798 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2479_2798 (acsA)
   00620 Pyruvate metabolism
    LMOSLCC2479_2798 (acsA)
   00640 Propanoate metabolism
    LMOSLCC2479_2798 (acsA)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC2479_2798 (acsA)
Enzymes [BR:lmoy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LMOSLCC2479_2798 (acsA)
Lipid biosynthesis proteins [BR:lmoy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LMOSLCC2479_2798 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2823064..2824641
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHGETKTWSYHHLLEQANKFANVAKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGDKLSGWEQYETLMEAAPTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLHLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFRDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDADGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVVKDGYKGTDDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattaccgacgagattgctaaa
ttcagttctgaaaaaacagctttaatttggaaaaatgagcacggggaaacaaaaacttgg
agttaccaccatttgcttgaacaagcgaataaatttgccaatgttgcaaaagatgccggc
attaaaaaaggcgaccacgttatcgtcatgacacctagattactcgaaacgtacgcaatt
tatatgggcttatggaaagctggtgccattattatcccggcatccgaactccttaaagca
cacgatttagaatatcgtatccaccacgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaattattgtt
ggagataaattatctggatgggaacaatatgaaacattaatggaagctgctccaactgag
tttgaacgtgtagaaacctctcgcgatgacgcttgtctacttgctttcacaagtggaaca
acgggtaaccctaaaggtgttgtacatattcacggttggggttacgcgcatatccgtatt
gcggccgatcattggctagatattcacgaagacgatatcgtttgggctacagctggcccc
ggttggcaaaaatgggtttggtctcccttcctttctgtacttggaaaaggcgcgactggc
ttcatttacaacggtcgtttcattccagaaaaacaactccatttactggaagaagaaaaa
atcaacgtgctctgctgtacgccaacagaatatcgcttaatggcaaaggttaataatttg
cgcgaacatgatttaagttcccttcgtagcgccgtatcagcaggagaacctctaaaccgc
gaagtaattcaagttttccgagataattttgatattaaagttcgcgacggctacggtcaa
acggaaagtacgctgttgattggaacacttgttgatacgccgattcgtcctggttcaatg
ggcaaaccaattatgcctgaatacatggcgattattgatgctgacggaaatccagttggt
gtcggtgaaattggtgatatcgcgatgcgtagagatttcccagcacttttcaaagaatac
tataaagaaccagaacgtttgcaaaaagcgattcgtggtgattatttcgtttctggtgac
cgcgctatccgcgatgaagataattattactggttccaagggcggaatgacgatattatt
atcagctctggctacacgattggcccgttcgaagtcgaggacgcgctcacacatcaccca
gccgtaaaagaagtcgctgttgtcgcaagtcctgacgaaatccgcggaaccgttgtaaaa
gcgtttatcgtcgtaaaagatggctacaagggcaccgatgatcttgtgcatgaattacaa
acatttacgaaagaacaaaccgctccctataagtatccgcgccggattgagtttgttgag
gcattaccgaaaactgattctggtaaaattcgtcgcgttgagttgcgtgatgcggagttt
gctagtgtgcatggataa

DBGET integrated database retrieval system