KEGG   Listeria monocytogenes SLCC2479: LMOSLCC2479_2798Help
Entry
LMOSLCC2479_2798  CDS       T02241                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lmoy  Listeria monocytogenes SLCC2479
Pathway
lmoy00010  Glycolysis / Gluconeogenesis
lmoy00620  Pyruvate metabolism
lmoy00640  Propanoate metabolism
lmoy00680  Methane metabolism
lmoy01100  Metabolic pathways
lmoy01110  Biosynthesis of secondary metabolites
lmoy01120  Microbial metabolism in diverse environments
lmoy01130  Biosynthesis of antibiotics
lmoy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmoy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMOSLCC2479_2798 (acsA)
   00620 Pyruvate metabolism
    LMOSLCC2479_2798 (acsA)
   00640 Propanoate metabolism
    LMOSLCC2479_2798 (acsA)
  Energy metabolism
   00680 Methane metabolism
    LMOSLCC2479_2798 (acsA)
Enzymes [BR:lmoy01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     LMOSLCC2479_2798 (acsA)
Lipid biosynthesis proteins [BR:lmoy01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   LMOSLCC2479_2798 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CBY59069
Position
2823064..2824641
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHGETKTWSYHHLLEQANKFANVAKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGDKLSGWEQYETLMEAAPTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLHLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFRDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDADGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVVKDGYKGTDDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattaccgacgagattgctaaa
ttcagttctgaaaaaacagctttaatttggaaaaatgagcacggggaaacaaaaacttgg
agttaccaccatttgcttgaacaagcgaataaatttgccaatgttgcaaaagatgccggc
attaaaaaaggcgaccacgttatcgtcatgacacctagattactcgaaacgtacgcaatt
tatatgggcttatggaaagctggtgccattattatcccggcatccgaactccttaaagca
cacgatttagaatatcgtatccaccacgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaattattgtt
ggagataaattatctggatgggaacaatatgaaacattaatggaagctgctccaactgag
tttgaacgtgtagaaacctctcgcgatgacgcttgtctacttgctttcacaagtggaaca
acgggtaaccctaaaggtgttgtacatattcacggttggggttacgcgcatatccgtatt
gcggccgatcattggctagatattcacgaagacgatatcgtttgggctacagctggcccc
ggttggcaaaaatgggtttggtctcccttcctttctgtacttggaaaaggcgcgactggc
ttcatttacaacggtcgtttcattccagaaaaacaactccatttactggaagaagaaaaa
atcaacgtgctctgctgtacgccaacagaatatcgcttaatggcaaaggttaataatttg
cgcgaacatgatttaagttcccttcgtagcgccgtatcagcaggagaacctctaaaccgc
gaagtaattcaagttttccgagataattttgatattaaagttcgcgacggctacggtcaa
acggaaagtacgctgttgattggaacacttgttgatacgccgattcgtcctggttcaatg
ggcaaaccaattatgcctgaatacatggcgattattgatgctgacggaaatccagttggt
gtcggtgaaattggtgatatcgcgatgcgtagagatttcccagcacttttcaaagaatac
tataaagaaccagaacgtttgcaaaaagcgattcgtggtgattatttcgtttctggtgac
cgcgctatccgcgatgaagataattattactggttccaagggcggaatgacgatattatt
atcagctctggctacacgattggcccgttcgaagtcgaggacgcgctcacacatcaccca
gccgtaaaagaagtcgctgttgtcgcaagtcctgacgaaatccgcggaaccgttgtaaaa
gcgtttatcgtcgtaaaagatggctacaagggcaccgatgatcttgtgcatgaattacaa
acatttacgaaagaacaaaccgctccctataagtatccgcgccggattgagtttgttgag
gcattaccgaaaactgattctggtaaaattcgtcgcgttgagttgcgtgatgcggagttt
gctagtgtgcatggataa

DBGET integrated database retrieval system