KEGG   Listeria monocytogenes J1816: LM1816_06745Help
Entry
LM1816_06745      CDS       T02801                                 

Definition
5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lmoz  Listeria monocytogenes J1816
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lmoz03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2493942..2494763
Genome map
AA seq 273 aa AA seqDB search
MPEMPEVENVRATLQELVPGKKIDQVIVRVPKMIVSTPPDEFVHMLVGQEIEGVRRRGKF
LLFDLTNCTILSHLRMEGKFRLMDEKEEVSKHTHIIFHFEDHTELRFLDVRKFGTMEVTN
KYGEGETRSIKKLGPEPLTQAFTSTDFATGVKKTSRAIKTALLDQKLVAGVGNIYADEIC
FEAKVRPERAANSLSDKEIKRIFEATKSIMTEAVALGGSTVRTYVNSQGKLGQYQDKLKV
YGKTDEPCVVCGKPIEKIKLNGRGTHFCPNCQK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaatgccggaagtagaaaatgtccgcgcaactttacaagaattagtcccaggt
aaaaaaatagatcaagtaattgttcgtgttccaaaaatgattgtatcaacaccacccgat
gagtttgtgcatatgcttgtcgggcaagaaatagagggtgtacgccgtcgtggtaaattc
ttactttttgacttaaccaactgtacgattttatcgcatttacgaatggaaggtaaattt
cggttaatggatgaaaaggaagaggttagcaagcatacgcatattatttttcattttgaa
gatcacacggaattgcgttttttagatgtgcgaaaatttggcacgatggaagtaacaaat
aaatacggtgagggtgaaacgcggtcgattaaaaagcttggcccagaaccgctgacgcaa
gcctttacatcaacggattttgcgactggtgtaaaaaaaacaagccgcgccatcaaaacg
gctttacttgatcaaaagttagtagccggagtaggaaatatttatgcggatgaaatttgt
tttgaagcaaaagtgcgcccggaaagagcagctaactcactttcagacaaagaaatcaaa
cgtatttttgaagcgacgaaaagtattatgactgaagctgtagcacttggtggctccact
gtcagaacatatgtaaattcgcaagggaagcttggacaatatcaagataaattaaaagta
tacggcaaaacagacgaaccgtgtgttgtttgtggaaagccaattgaaaaaattaaatta
aacggacgcgggacacatttttgcccgaattgccaaaaatag

DBGET integrated database retrieval system