KEGG   Listeria monocytogenes J1816: LM1816_06845Help
Entry
LM1816_06845      CDS       T02801                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lmoz  Listeria monocytogenes J1816
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmoz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(214238..215617)
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDKKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQEQDQALGEFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQAVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDALPKAIAAALPKENLH
TAKQATNITKKNSSYEISFVDGDKMEADGVIIAATHDALIHLLAEKTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPENKMLLRGFVGKAGE
TWLEQASDEAIVSAVLRDYAEMMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNIK
ADYPGVYFAGMSYEGVGIPDCIAGAQTAAKELVDYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggcttgcagcagcgtatgaacta
caaaaaacacatccgaattatacgtgggaattagtagaaaaagacaaaaaactaggcggg
aaatttgaaacggttaaacgggacggatttttaattgaaaaaggaccagactccttttta
gcaagaaaaccagctggtgtaggcttagtgaaggatttaggactcgaagataaactgatt
gcgaacgcgacaggaagatcctacatttaccaccaaaaagcacttcatccgattccagaa
ggctcagtgatgggaattccaacagataaagaagcattgctagctagtacactcgtatcc
gaaattgggaaagctcgcgcacttcaagaaccaacaatggaacgaaataatcaagaacaa
gatcaagcacttggcgaattctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggagatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaagcagttaaaaaatatgggaatttgatggatggcttaaaa
gaaagtagcatgcaaacgacagggacaaaagctactattggtgcttttcgaacattagaa
ggcgggctagatgcgttaccaaaagccattgccgccgcacttccaaaagaaaatttgcat
acagcaaaacaagcaacgaacattacgaaaaagaatagctcttacgaaatttcttttgta
gatggcgataaaatggaggcagatggcgtcattatcgctgccacacatgatgcgctaatt
catttattagcagaaaaaacgacagaaccattcgcgggacaaccgcttacgactctcgca
actgtctcattagcatacaatgaacaagatgtaccgattttaccagatggaacaggctat
ctagttgccagaaccgccccatataaaaccactgcttgtacatgggtgcagaaaaaatgg
ccgcatatggtaccagaaaataaaatgttactacgaggctttgttgggaaagcgggagaa
acttggttagagcaagcaagtgatgaagcaatcgtttcagctgttttgagagattatgcg
gaaatgatggaccttcacgccgcgccacttttttatgaagtaagccgaatgaaatccgca
atgcctcaatacttagttaatcaccaggaccgactaaaacaattgaaaaagaacatcaaa
gcagattacccaggggtttattttgcaggaatgagctacgaaggtgtgggtattcctgat
tgcatcgcaggagctcaaacagccgctaaggaattagtagattacttggaagaggtgtaa

DBGET integrated database retrieval system