KEGG   Listeria monocytogenes J1816: LM1816_10352Help
Entry
LM1816_10352      CDS       T02801                                 

Definition
penicillin-binding protein
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
lmoz  Listeria monocytogenes J1816
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lmoz00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LM1816_10352
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    LM1816_10352
Enzymes [BR:lmoz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     LM1816_10352
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     LM1816_10352
Glycosyltransferases [BR:lmoz01003]
 Polysaccharide
  Bacterial polysaccharide
   LM1816_10352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1760119..1762263
Genome map
AA seq 714 aa AA seqDB search
MDKFKQQLIKYLKLFFGFIGKWLSKGWQKFRRFWKNKHIGKIFLLAGLVFLLSFIIYLVI
VAKSADIDALKKGLESATIIYDKDGDKAGELSSTDATFVSIDKISKNLQNAVVSIEDRKF
YEHKGFDLKGIARAGVNLVTSGGISGGGSTITQQLAKNALLTQEQTFTRKAKEIFMAREI
EKTYSKDEIMEMYLNRSYFGNGEWGVENASLKYFGKSAADLNIPEAATIAGLLQAPSAYD
PYQHIDKATNRRNMVLNAMVETGTISKAEGDKYKATKIVLNDQSKDPLANKYPWYVDAVI
NEAVNEADITQDEIMQKGYKIYTELDQNYQTSLENVYNNDGLFPSNANDGTLVQSGAVLM
DPATGGIRALVGGRGEHVFRGFNRATQMKAQPGSTMKPLAVYTPALQSGYDVDSMLKDEK
ITYKGNYTPTNVGGVYSGEVPMYKAVANSINAPAVWLLDQIGIDKGVKSVEKFGITVPEK
DRTLGLALGGMSKGASPVEMATAYATFANNGAKPESHIITKIVDPSGNTVYENVPKTKQI
ISETVSNEMTSMLLDVINTGTGQSAAVSGHEMAGKTGSTQVPFDDTSGTKDQWFVGYTPN
LVGAVWMGYDKTDKEHYLTTTSSAGVSSLAHYVMNSGLQYQKSADFSTKSAAQETAAKKE
EEEKEKNSGSDFWSGVKEKADEAGETIKKGADKVKEFGGKVSDGIGNLIDSIGN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggacaaattcaaacagcaactaattaaatacttaaaattattctttggttttatagga
aaatggcttagcaaaggatggcagaaatttagacgtttctggaaaaacaaacatatcgga
aagatttttttactagctggacttgtatttttattaagttttatcatttatcttgtaata
gtagcaaaatctgccgacatagatgcactaaaaaaaggcttagagtcagccacgattatt
tatgacaaagatggcgacaaggcaggggagctttcttccactgatgcaacatttgtatcc
atcgataaaatatctaaaaacttacaaaatgcagtagtttccattgaagatagaaaattt
tatgaacataaaggttttgacttgaaagggatagctcgggcgggtgttaatttagtcact
agcggaggcatttctggtggcggtagtacgattacacagcaactcgccaaaaatgctcta
ctgacacaagaacaaaccttcacacgaaaagccaaagaaatatttatggctcgtgaaatc
gaaaaaacctactcaaaagacgaaattatggaaatgtacttaaaccgttcttactttggt
aatggggaatggggagtagaaaatgcttccttaaaatattttggtaaatcagcggcagac
ttaaacataccagaagctgcgacaattgctggattgcttcaagctccaagtgcgtatgat
ccataccaacatatcgacaaagcgactaatcgccgcaacatggtattaaatgcaatggtc
gaaacaggcacaatttcaaaagcagaaggcgataaatacaaagctacaaaaatagtttta
aatgatcaatcaaaagatccacttgcgaataaatatccatggtacgtcgatgcagttatt
aatgaggctgtaaatgaagcagatataacgcaagatgaaatcatgcaaaaaggatataaa
atctatacggaattagatcaaaattatcaaacttccttagaaaatgtttacaacaatgat
gggttattcccttctaatgcaaatgatggcacactagttcaatcaggagctgttttaatg
gatccagctactggaggcattagagcgcttgttggtggacgcggagaacatgtcttccgt
ggtttcaaccgggcgacacagatgaaagcacaaccaggttccacaatgaagccacttgcg
gtatacacaccggcgcttcaatctggttatgacgtggattcaatgctaaaagatgaaaaa
ataacctacaaaggtaactacacaccaaccaatgttggcggcgtttatagtggagaagtt
ccaatgtataaagctgtagccaactcgattaatgcccctgccgtttggttacttgatcaa
attggtattgataaaggtgtaaaatctgtcgaaaaatttggtattacagttccagaaaaa
gatagaacgcttggacttgcactcggtggtatgagtaaaggtgcttcgccagtagaaatg
gcaacagcgtatgcaacctttgctaacaatggtgccaaaccggaatctcatattattact
aaaattgtcgatccatcaggcaatacagtttacgaaaatgttcctaaaactaaacaaatc
atttcagaaacagtatctaatgaaatgacttccatgcttttagatgttatcaatacagga
actggtcaaagtgcagctgtttccggtcacgaaatggctgggaaaacaggttccacgcaa
gttccatttgatgatacaagcggtactaaagatcaatggtttgttggctacacgccaaac
ctagtcggagccgtttggatgggatatgataaaactgacaaagagcattacctaactaca
accagttctgctggtgtttctagtttggctcactacgtaatgaatagtggtttgcagtat
cagaaatccgcagactttagtacgaagagtgctgcacaagaaactgcagcgaaaaaagaa
gaagaagaaaaagagaagaacagtggtagcgacttttggagtggcgtgaaagaaaaagcc
gatgaagctggagaaacaatcaaaaaaggcgcagataaagtaaaagaattcggtggaaaa
gtttctgatggcattggaaacttaatcgactcgataggtaattaa

DBGET integrated database retrieval system