KEGG   Listeria monocytogenes J1816: LM1816_15867Help
Entry
LM1816_15867      CDS       T02801                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lmoz  Listeria monocytogenes J1816
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lmoz00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1461221..1461796
Genome map
AA seq 191 aa AA seqDB search
MAQLFFRYGSMNSGKTIEILKVAHNYEEQNKTVAIFTSGIDDRDQVGFISSRIGLKREAT
PIFSDTNIFEIVANIKPKPNCVLLDESQFLEKEHVFQLAKIVDELNIPVIAYGLKNDFRN
ELFEGSKYLLLYADKLEEMKTICWFCAKKATMVLRVDDKGKPVYTGEQIMIGGNDHYYPV
CRKCHANPPIK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcacaattatttttccgttatggttccatgaatagtgggaaaaccattgaaattcta
aaagtcgcacataattatgaagaacaaaataaaacagtggctatctttacttcaggtatt
gacgatagagaccaagttggcttcatttcaagtcgaattggactgaaacgagaagcaact
cctatttttagtgacacaaatatttttgaaatcgtagcgaatattaaaccaaaaccaaat
tgcgttcttttagatgaatcgcaatttctagaaaaagaacacgtatttcagttagcgaaa
attgtggatgaattaaatatcccagttattgcttatggtttaaaaaatgattttcgaaat
gaattattcgaaggctcgaaatacttgctattatatgcagataaactagaagaaatgaaa
acaatttgctggttttgtgctaaaaaggcaacgatggttctgcgcgtggatgacaaagga
aaaccagtttatacaggtgaacaaattatgattggcggaaatgaccactattaccctgtg
tgtcgcaaatgtcatgccaatccaccaataaaataa

DBGET integrated database retrieval system