KEGG   Listeria monocytogenes 07PF0776: MUO_01265Help
Entry
MUO_01265         CDS       T02040                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MUO_01265
Enzymes [BR:lmp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MUO_01265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236432..237247
Genome map
AA seq 271 aa AA seqDB search
MKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGISTRPG
FSEVTPEEELNRIIPVIKAVRTKLPDIWISVDTWRAEVAEKAILAGANMINDQWGAKKEP
KIAEVAAKYNVPICLMHNRENTQYDNFLEDVKKDLLESVAIAKAASVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPEDRMEGTGATTVYGFSKG
CTITRVHDVLPIARMVRMTDAITGKLDITKL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagtggaaaagggatcacttaggtatggtcatggggatactgaatgttacgcca
gactctttttcggatggcgggaaatatatgcaagtggaagaagctgtggctcgagcgtta
caaatggcagaagatggagcagcaattattgacgttggtggaatatctactcggcctggt
ttttcagaggtaacgcctgaggaagaacttaatcgaattattcctgtcattaaagctgtt
aggacaaaacttccggatatatggatttctgttgatacttggcgtgccgaagtggctgaa
aaagctattttagcaggagctaatatgataaatgatcaatggggtgccaaaaaagaaccg
aaaattgctgaagtagctgcgaaatataacgtgccaatttgtttgatgcacaaccgagaa
aacacgcaatacgataattttctggaagatgtgaagaaagacttattagaaagtgttgca
attgctaaagcggcatccgtgccagatgaacatattattcttgatccgggtttcggtttt
gttaagacgcctgcgcagaatttagaagtgttacgacgcattgatgagatagtggcgctt
ggttacgaggttttacttggtacgagtagaaagtcgacaattggtctcgtcttaggaact
actccagaggatagaatggaaggaactggggcgacaaccgtttacggattttcgaaaggt
tgcacaattactcgtgtacacgatgtacttccaattgcgcgcatggtaagaatgacagac
gcgattacgggcaaattagatattacaaaattataa

  All links  
No link information was found.   
DBGET integrated database retrieval system