KEGG   Listeria monocytogenes 07PF0776: MUO_01265Help
Entry
MUO_01265         CDS       T02040                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lmp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
236432..237247
Genome map
AA seq 271 aa AA seqDB search
MKKWKRDHLGMVMGILNVTPDSFSDGGKYMQVEEAVARALQMAEDGAAIIDVGGISTRPG
FSEVTPEEELNRIIPVIKAVRTKLPDIWISVDTWRAEVAEKAILAGANMINDQWGAKKEP
KIAEVAAKYNVPICLMHNRENTQYDNFLEDVKKDLLESVAIAKAASVPDEHIILDPGFGF
VKTPAQNLEVLRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPEDRMEGTGATTVYGFSKG
CTITRVHDVLPIARMVRMTDAITGKLDITKL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaagtggaaaagggatcacttaggtatggtcatggggatactgaatgttacgcca
gactctttttcggatggcgggaaatatatgcaagtggaagaagctgtggctcgagcgtta
caaatggcagaagatggagcagcaattattgacgttggtggaatatctactcggcctggt
ttttcagaggtaacgcctgaggaagaacttaatcgaattattcctgtcattaaagctgtt
aggacaaaacttccggatatatggatttctgttgatacttggcgtgccgaagtggctgaa
aaagctattttagcaggagctaatatgataaatgatcaatggggtgccaaaaaagaaccg
aaaattgctgaagtagctgcgaaatataacgtgccaatttgtttgatgcacaaccgagaa
aacacgcaatacgataattttctggaagatgtgaagaaagacttattagaaagtgttgca
attgctaaagcggcatccgtgccagatgaacatattattcttgatccgggtttcggtttt
gttaagacgcctgcgcagaatttagaagtgttacgacgcattgatgagatagtggcgctt
ggttacgaggttttacttggtacgagtagaaagtcgacaattggtctcgtcttaggaact
actccagaggatagaatggaaggaactggggcgacaaccgtttacggattttcgaaaggt
tgcacaattactcgtgtacacgatgtacttccaattgcgcgcatggtaagaatgacagac
gcgattacgggcaaattagatattacaaaattataa

DBGET integrated database retrieval system