KEGG   Listeria monocytogenes 07PF0776: MUO_01450Help
Entry
MUO_01450         CDS       T02040                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lmp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
279818..281260
Genome map
AA seq 480 aa AA seqDB search
MQIKNKAMLITYSDSLGKNMEELSKVMETYFEDAVGGIHLLPFFPSTGDRGFAPSDYTTV
DSDLGSWEIIEKLGEKYYLMFDFMINHISRESLFFQDFKKEHLNSKYKDMFIRINDFFPP
GRPNEKDLDLIYKRKDKAPFQEVEFADGETELVWNTFGEEQIDLDVTAEVTKEFIRQTIK
NMAAHGCSILRLDAFAYAIKKLDTNDFFVEPEIWDLLDEVKAEAAKYDMELLPEIHEHYS
IQMKIANHDYYIYDFALPMVMLYSLYSGRVERLANWLEMSPMKQFTTLDTHDGIGVVDAR
DLLTDEELDYTSAELYKIGANVKKIYSSEKYNNLDIYQINSTYYSALGDDDKSYLLARVI
QCFAPGIPQIYYVGLLAGKNDIDLLEETKEGRNINRHYYTIDEIKNEVKRPVVKALCNLL
RFRNTSEAFDLEGSIEIETPSSNEIVIIRKNKTNKITATLKANLSTKTFQISENERNILI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaattaaaaataaagctatgttaattacttattctgatagtttagggaaaaatatg
gaagaattatccaaggtgatggaaacttattttgaagatgctgttggcgggattcactta
ttgccgttctttccatccactggagatcgagggtttgcgccaagtgattacacaacagta
gatagcgacctaggttcttgggaaataatcgagaaattaggcgaaaagtattatttaatg
tttgattttatgattaatcacatttctcgcgaatcactcttctttcaagattttaaaaaa
gagcatttaaactcaaagtataaagatatgtttattcgtatcaatgatttctttcctccg
ggtagaccaaatgaaaaagacttagatttaatttataagagaaaagataaggcgcctttt
caagaagttgaatttgctgatggggaaacggaattagtttggaatacttttggggaagaa
caaattgatttagatgtgacagccgaagttacaaaagaatttattcgtcaaacgataaaa
aatatggctgcacatggttgttctattttgcgtcttgatgcctttgcttatgcaattaaa
aaattagatacaaatgatttttttgtagaaccggaaatttgggatttactggatgaagtg
aaagcagaagcggccaaatatgacatggaattattaccagaaattcatgaacattattcc
atccaaatgaaaatcgcgaaccatgattattatatctatgattttgcgttacccatggtg
atgctgtactcgttatatagtggccgagtggaacgtttagctaactggttagaaatgagt
ccgatgaagcaatttactactttagatacgcatgatggcattggcgttgtggatgcacgc
gatttattaacagatgaggaactcgattatacttcagcagaattatacaaaataggagct
aatgttaaaaagatatattcctctgaaaaatataataacctggatatttatcaaattaat
agtacctattatagtgctttgggtgacgatgataaaagttacttgttagcgagagtaatt
caatgttttgcgccggggattccgcaaatttattatgttggtttacttgctggcaaaaat
gatattgaccttttagaggaaacaaaagaagggcgtaatattaatcgtcattactacaca
atagatgaaattaaaaatgaagtaaaaagaccagttgttaaagcgttgtgcaatttactg
aggtttagaaatacttctgaagcgtttgatttggaaggaagtatagaaattgagacacct
agctcaaatgaaatcgttattattcgcaaaaacaaaacaaataaaattacagcgacatta
aaagcaaatttaagtactaaaacattccaaatcagcgaaaatgaaagaaatattttaatt
taa

DBGET integrated database retrieval system