KEGG   Listeria monocytogenes 07PF0776: MUO_03120Help
Entry
MUO_03120         CDS       T02040                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmp00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
615479..616873
Genome map
AA seq 464 aa AA seqDB search
MTYKFPENFWWGSAASGPQTEGAANVDGRKPSIWDHWYKIEPGRFFNDVGPTNTSNFYYQ
YKEDIALMKQTGHNSFRTSIQWSRLIPDGIGEVNPKAVDFYNRVIDEMLANDVEPFMNLY
HFDMPMSMQEKGGFESREVVDAYATFAKTCFELFGDRVKHWFTFNEPIVPVEAGYLYDMH
YPNVVDFKRATQVAYHTTLAHALAVKEFHALEIPEGQIGIILNLTPSYPRSQNPADLKAA
HIADLIFNRSFLDPVTKGEFPADLVEIIREHDALPEYTEEDLAIIKNNIIDILGVNYYQP
RRVKAKEYAAHPDAPFMPEHLFDNYEMPYRKMNPYRGWEIFERAIYDIAINLRDNYDNIP
FFISENGMGVEGESRYRNADGMIEDTYRIDFIKSHLKWLHKAIEEGSNCHGYHLWTFMDC
WSWANAYKNRYGLVEVDLDNNFKRTIKASGHWYKELSENNGFED
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaatttccagagaatttttggtggggaagtgcggcgtccggcccacaaaca
gaaggcgcagcaaatgtagatggcagaaaaccgagtatttgggatcactggtacaaaatc
gaaccaggtcgtttctttaacgatgtaggacctacgaatacatctaatttttactatcaa
tataaagaagatattgctttaatgaaacaaactgggcataattctttccgtacttcgatt
cagtggtcacgtcttattccagatggtattggcgaagtgaatccgaaagcggttgatttt
tacaatcgcgttattgatgaaatgcttgcaaatgacgtggaaccatttatgaatttatat
cattttgatatgccaatgtcgatgcaagaaaaaggcggttttgaaagccgtgaagtagtt
gacgcgtatgcaacttttgcgaaaacatgttttgaattattcggagatcgtgtgaaacat
tggtttacttttaatgaaccaattgttcctgttgaagcaggttacttatacgatatgcac
tatccgaatgtcgttgattttaaacgtgcgactcaggttgcttaccatactactttggca
catgcgcttgctgttaaagaattccacgcacttgaaattccagaaggccaaattggaatc
attttaaacttaacaccgtcgtatccaagaagccaaaatccggcagatttaaaagcggct
catattgcagatctaattttcaaccgtagtttccttgatccggttacaaaaggggaattc
ccagctgaccttgttgaaattattcgcgaacatgacgcgcttccagaatatactgaagaa
gatttggcgataattaaaaacaacattattgatattcttggtgtaaactactaccaaccg
cgtcgtgtgaaagcgaaagaatacgcagctcatccggatgcaccatttatgccagaacat
ctttttgataactatgaaatgccttaccgcaaaatgaatccatatcgtggttgggaaatt
ttcgaaagagcgatttatgatattgcgattaatctgcgtgataactacgataatattcca
ttcttcatttctgaaaatggtatgggtgtagaaggcgaaagtcgctaccgtaatgcagac
ggaatgattgaagatacgtaccgaatcgatttcattaagagtcacttgaaatggctgcat
aaagccattgaagaaggttctaactgtcatggttatcatctttggacattcatggattgc
tggagctgggcgaatgcttacaaaaaccgttatggcttagtagaagttgatttagacaat
aatttcaaacgtactataaaagcatccggacattggtacaaagaactttcagaaaacaat
ggttttgaagactaa

DBGET integrated database retrieval system