KEGG   Listeria monocytogenes 07PF0776: MUO_05190Help
Entry
MUO_05190         CDS       T02040                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MUO_05190
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MUO_05190
Enzymes [BR:lmp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MUO_05190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1012216..1012695
Genome map
AA seq 159 aa AA seqDB search
MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGANFEILG
FPCNQFLRQDPGSDEEILEFCQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEW
NFAKFLIDENGEVVERFPSKMKPADFEDKVEALVAKVNN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtccatgatttttctgaaaaagcaatgaatggcaaagaaatagctttaagtgat
tataaaggtaaggtattactcatcgtgaatactgcgagtaaatgtggcttaacaccccaa
ttagaaggtctcgaagcaatgtataaaaaattgggtggcgctaattttgaaatcctcggt
ttcccgtgtaaccagtttttgcgacaagatcctggcagtgatgaggaaattttagaattt
tgccaaatgaattatggtgtgactttccaaatgttttccaaaattaaagtaaaaggcaaa
gatgccagcccactttataaatatttaaccgaacaaacgggtggtaaaaaagtagaatgg
aactttgcgaaattcttaattgatgaaaatggagaagttgttgaacgtttcccatctaaa
atgaaaccagcagattttgaggataaagtggaagcacttgttgcgaaagtaaataattaa

DBGET integrated database retrieval system