KEGG   Listeria monocytogenes 07PF0776: MUO_05445Help
Entry
MUO_05445         CDS       T02040                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MUO_05445
Enzymes [BR:lmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MUO_05445
Exosome [BR:lmp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MUO_05445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1060715..1062178
Genome map
AA seq 487 aa AA seqDB search
MKKHYQIAIDQSTSGTKVLLFKAGELVDRLDKKHRQLYPKKGWVEHNPIEICQNVRTLIV
DILAKHDLIPADIERLALTNQRETIVAWDKQTGKPLYNAIVWQCNRTKELCETLKKAGYE
KRIKQLTGLKIDSYFSASKMKWLLENSSAVRDAASRNQLAFGTMDAWLLFSLTDDSNYFT
DRTNASRTLLYDIEKNDWSDELLELFGVKRAYLPEVKQSAGSFGSYQEIPIHSVMADSEA
ALYGQGCDAFGAVKATLGTGCSVMMQIGENRLPENDAILTTLAWDVAGVNQFALEGIIRS
CGDTLVFLSEQLELFNDYDTACKRAFQLPCNEGVVLIPGQLGLGSPYWNTDIRAEILGLT
REHTKWHIIRAGFTSIAFQIKAVIDQMELMTGQNIKRLQVDGGLTKQHELMQYLADVLKA
EVAVSPAEELSAIGAIEIADNKLQNKRTIAKLYQPNITHTHALEDFQEWEKQVKSSILKL
QKVRNFK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacactatcaaatcgctattgatcaaagcacatctggaacgaaagtattattg
tttaaagcaggtgaacttgtagatcgtttagataaaaagcatcgacagttgtatccgaag
aaaggctgggtagagcataatccaatcgaaatttgtcaaaatgtccgtacattaattgtg
gacatattggcaaaacatgatttaattccagcggatatcgagcgacttgctttgacgaat
caacgggaaacaattgtagcttgggataaacaaacgggcaagccactttataatgcgatt
gtatggcaatgtaatcgaacaaaagaactttgcgaaacattaaaaaaagctggttatgaa
aaaagaattaaacagcttaccggattgaaaattgattcttatttttctgcttctaaaatg
aagtggttattggaaaatagttctgcggtgcgggatgcagcaagtcgtaatcaattggca
tttggtacaatggatgcttggttgttattttcgcttacggatgatagtaattatttcaca
gaccgaacaaacgccagccgcacactcctttatgatattgaaaaaaatgattggtcagat
gagttactcgaactttttggagttaaacgtgcttatttaccagaagtgaagcaatctgct
ggaagttttggaagttatcaggagataccgattcatagtgtgatggctgattcagaagcg
gcactttatggacaaggctgtgatgcatttggggcagtgaaggcgacgcttgggacagga
tgctctgttatgatgcaaattggtgagaacagattacctgaaaacgatgctattttgaca
actcttgcctgggatgttgcaggcgtgaaccagtttgcgttagaaggaattattcgttct
tgtggagacacattggtttttttatccgaacaattagaactatttaatgattacgataca
gcttgtaagcgagcatttcaattaccatgcaatgagggtgttgtgctaattcctggacaa
ttaggtttaggttcgccttattggaatacagatatacgagcagagattcttggtctcaca
cgagaacatacaaaatggcatattattcgtgccggttttacaagtattgcatttcaaatt
aaggctgttattgaccaaatggagttaatgacaggtcaaaatattaagcgcttacaagta
gacggtggattaacaaagcaacatgagttgatgcaatatttagcagatgttttaaaagca
gaagtggcagtcagtcccgcggaagaactttcggcaattggtgctattgaaattgccgac
aataaactacaaaataagagaacgatagcaaaattgtaccaaccaaatatcactcataca
catgctttggaagattttcaagaatgggaaaaacaagtgaaaagcagtattctaaaatta
cagaaggtgaggaattttaaatga

DBGET integrated database retrieval system