KEGG   Listeria monocytogenes 07PF0776: MUO_05665Help
Entry
MUO_05665         CDS       T02040                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MUO_05665
   00052 Galactose metabolism
    MUO_05665
   00500 Starch and sucrose metabolism
    MUO_05665
   00520 Amino sugar and nucleotide sugar metabolism
    MUO_05665
Enzymes [BR:lmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MUO_05665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1110507..1111394)
Genome map
AA seq 295 aa AA seqDB search
MRVKKAVIPAAGLGTRFLPATKAMPKEILPIVDKPTIQYIVEEAVASGIEDILIVTGKGK
RAIEDHFDSVPELENNLREKNKLELLHLVEQTTNINLHFIRQAKPKGLGDAILQAKGFVG
NEPFIVMLGDDIVESKIPCSKQLMNQYEKTHSSVIGVQTVPHEETYRYGIIDPINEYDKN
LYNVKGFVEKPDPANAPSDLAILGRYLLTPQIFDFLETQKPGAGGEIQLTDAINSLNEVQ
RVFAYDFEGQRFDVGDKFGFIQTTMQFALKHPEIKDDVKDLINDLYNQIHKKDKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaaaaaaagctgtaattccagctgctggtctaggcacgcgctttttaccagca
acaaaagcaatgcctaaagaaatcttaccaattgtggataaaccaactattcaatacata
gtagaagaagcagtagcatctggcatagaagatattttaattgtaaccggtaaaggtaaa
cgtgctatcgaagaccattttgattccgttcctgaacttgaaaacaatctacgggaaaaa
aataaacttgaattactacatttagtagaacaaactactaacattaatttgcactttatt
cgtcaagcgaaaccaaaaggacttggtgatgccatccttcaagcaaaaggctttgtgggt
aatgaaccatttatcgttatgttaggtgatgatattgttgaatccaaaatcccttgttcc
aaacaattaatgaatcaatatgaaaagacgcatagttccgtcattggagtccaaactgtc
cctcacgaagagacatatcgttatggtattattgatccaattaatgaatatgataagaat
ttatataatgtgaaaggttttgtggaaaaaccagatcctgctaatgcaccgtctgattta
gctatccttggccgttacttattaacaccacaaattttcgacttcttagaaacgcaaaaa
ccaggtgcaggaggcgaaattcaactaaccgatgcaatcaatagtctaaatgaagtacaa
cgtgtatttgcttatgactttgaaggacagcgttttgatgttggcgataaattcggcttt
atccaaacaacaatgcaattcgctttgaagcatcctgaaatcaaagatgatgtgaaagat
ctgattaacgacttatataaccaaattcataaaaaagataaaaaataa

DBGET integrated database retrieval system