KEGG   Listeria monocytogenes 07PF0776: MUO_06195Help
Entry
MUO_06195         CDS       T02040                                 

Definition
uroporphyrinogen-III methyltransferase/uroporphyrinogen-III synthase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lmp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1199251..1200732
Genome map
AA seq 493 aa AA seqDB search
MGKVMLIGAGPGDAQLLTVKGLAALQKADVIVYDRLVEPAMLQERKASCKLIYVGKEPLH
HPITQEEIEQILVKEAATNELVVRLKAGDPYVFGRGGEEGETLYKAGIPFEVIPGITSAI
GGLAYAGIPVTHRDFASSFHVITGHLKKGRDPLDWEALARLEGTLVFLMGMTNLPNICAN
LLENGRKAETGVAIVQWASRGKQLTVTGNLQNIEQKVAESGISSPALIVVGDVVSLRPQL
NFFEEMPLFHTKVLLPRARAGKSMLAEQIRDLGGEVTMYPNIQVVDVVPTKTKEELSEVS
ELLFTSKEAVERFFDYLAQLDLDIRSLKNTHLTAIGKQTKEAFSEKGIIPDSFIKRRSTE
LILEHLPRLQKNVSNLIIGSIVDTAEVTAILAEVEAMEMMPLYDMRPVTERPFDLASFEQ
VCFSSSRSVQNLLDVLTTEEKAILQTKTILSIGRFTSATLASFGINNFIEAESATPESLI
ELIQKTKLEGVPQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtcatgttaattggtgcaggtcctggagatgcacagctgctaaccgtgaaa
ggtttagctgcactgcaaaaggcagatgttattgtatacgatcgcctcgttgaaccagcg
atgctccaagaacgaaaagctagttgtaaactcatttatgtcggaaaagaaccacttcat
catccaattacccaagaggaaatcgagcaaattcttgttaaagaagctgcgacaaatgag
ctggttgttcgtctaaaagcaggagacccttatgtgtttggtcgcggcggggaagaagga
gagacactctataaagcgggaattccatttgaagttattcctggaatcacatccgcgatt
ggtgggcttgcctacgctggaatcccagtaacacatcgtgattttgcttcgagttttcac
gtgattaccggacatttgaaaaaaggacgcgatccactagattgggaagcccttgctaga
ctggaaggtacgctcgttttcctgatgggaatgactaatttgcctaatatttgtgcgaac
ttactagaaaatggtcgaaaagccgaaacgggtgttgcgattgtacaatgggcatctcgc
ggcaaacaattaacggttaccgggaacttacaaaacatcgaacaaaaagtagcggaatct
ggtatttcttcgccggcacttattgtcgttggtgatgtggtgagcttacgaccgcagctt
aacttctttgaggaaatgccacttttccatacaaaagtattacttccaagagcacgagct
ggaaaaagtatgctcgcggaacaaattcgcgatttaggcggagaagtaacaatgtatccc
aatattcaagtagtagatgttgtgccaacgaaaacaaaagaagaactaagcgaagtaagc
gaacttcttttcacatccaaagaagcggtagaacgattttttgattatttagcccagctt
gatttagatattcgttctctaaaaaatacccatcttaccgctattggcaaacaaacaaaa
gaagcttttagtgaaaaaggaattattccagatagtttcattaaaaggcggagcacggaa
ttaattttggagcatttaccacggttacagaaaaatgtgagcaacttaattatcggaagc
atagttgatacggcagaagttaccgcaattttagcagaagtggaagcgatggaaatgatg
ccgttatatgatatgcgtcctgtgacagaacgaccatttgaccttgcaagctttgaacaa
gtttgtttctcaagttcgcgttccgttcaaaatttactcgacgtactaacaaccgaagaa
aaagccattttacaaacgaaaacaattctttccattggaaggttcacgagcgcaacgtta
gcatcattcggtatcaacaattttatcgaagccgaaagcgccacaccagagagcttaatt
gaactaatccaaaaaacaaaattagaaggagtaccacaatga

DBGET integrated database retrieval system