KEGG   Listeria monocytogenes 07PF0776: MUO_06390Help
Entry
MUO_06390         CDS       T02040                                 

Definition
nucleoside-triphosphatase
Orthology
K02428  
XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MUO_06390
Enzymes [BR:lmp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     MUO_06390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1239331..1239942
Genome map
AA seq 203 aa AA seqDB search
MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGTTFAENAALKAETVAS
VLNQTVIADDSGLIVDALDGAPGVYSARYAGIAHDDAKNNEKLLKNLEGVEPDKRTARFH
CTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPEFGLTMAEIPAEKKNEIS
HRANAIKQLEKDLAEVVEKVTKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattattatcgctaccgcaaacaaaggaaaagcaaaagaattcgaaaaaatc
tttgcgaaatttaatatcgaagtagcaacccttgctgattttccagaaattggtgaaata
gaagaaactggaacaacctttgccgaaaatgccgctcttaaagcagaaacggtcgctagc
gtgttaaatcaaaccgtcattgctgatgattctggtttaatcgtagacgcgcttgacgga
gctcctggcgtctattccgcacgttatgcaggtatcgctcacgatgatgccaaaaataac
gaaaaactacttaaaaacttagaaggtgttgaaccggacaaaagaacggctcgtttccac
tgtacacttgctgtagccacaccttctgagaaaacatctttttataccggtgaagtagag
ggcgttatcgcagaacaactatgcggcacaaatggctttggctatgatccactatttttc
ttaccagaattcggtctaacaatggcagaaattccagcggagaaaaagaatgaaatcagc
caccgtgctaatgccattaaacaactagaaaaagatttagcagaagtagtagaaaaagta
accaaaaagtga

DBGET integrated database retrieval system