KEGG   Listeria monocytogenes 07PF0776: MUO_06805Help
Entry
MUO_06805         CDS       T02040                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
lmp00900  Terpenoid backbone biosynthesis
lmp01100  Metabolic pathways
lmp01110  Biosynthesis of secondary metabolites
lmp01130  Biosynthesis of antibiotics
Module
lmp_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MUO_06805
Enzymes [BR:lmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MUO_06805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom NAD_binding_3 Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFH79883
Position
1319194..1320336
Genome map
AA seq 380 aa AA seqDB search
MKKIILLGATGSIGTQTLAIIRENPEKFQIVALSFGRNMERGRAIIKEFKPKMVAVWHTR
DRVILEAEFPNVKFFNGLEGLREVATYLDGDVLLNAVMGSVGLLPTLDAIEAGKAIAIAN
KETLVTAGHLVMRAAKEKNISLLPVDSEHSAILQALNGENTERIEKLVLTASGGSFRDKT
REQLSEVTVKEALKHPNWNMGNKLTIDSATMFNKGLEVMEAHWLFGVDYDDIEVVIQRES
IIHSMVQFVDGSFIAQLGTPDMRMPIQYALTYPDRLYIPYEKEFRITDFSALHFEKVDYE
RFPALKLAYNAGKIGGTMPTVLNAANEIAVAGFLNGQVAFYNIEALVENAMNRHTSISDP
DLDTILQVDQETRAYVKTLL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattttgctaggtgcaactggttctattggaacacaaacgcttgcaatc
attcgcgaaaaccctgaaaaatttcaaattgttgcgcttagttttgggcgtaatatggaa
cgtggtagggcgattataaaagaatttaaacccaaaatggtcgctgtttggcatacgaga
gatcgtgtgatattagaagcagaattcccaaacgtgaaattttttaatggtttagaaggg
cttagagaagtagcgacctatttagatggagatgtgcttttaaatgcagttatggggagc
gttggcttacttccgacattagatgcaatcgaagctgggaaggccattgcaattgctaat
aaagaaacgcttgttacggctggacatttagtcatgcgtgcggcgaaagaaaaaaacatt
tcactattacctgttgatagcgaacattctgctattttacaagcattaaacggagaaaat
acggaaagaatcgaaaaactagttttgacagcgagcggtggaagtttccgagataagacg
agggaacaactcagcgaggttacggtgaaagaagcgttaaaacatccgaactggaatatg
gggaataaattaacaattgattcagcgacgatgtttaacaaaggtttggaagtgatggag
gcgcactggctgtttggtgtggactacgatgatatagaagtcgttatccagcgcgaaagt
attatccattctatggtgcagtttgtggatggaagtttcatcgcacaacttggaacgcca
gatatgcggatgccaattcaatatgctttaacctatcccgacagactttatataccgtat
gaaaaagaattccggattactgatttttccgcacttcattttgaaaaagtggattatgaa
agatttccggcattgaaactcgcgtataatgctggtaaaataggtggaacaatgccgaca
gttttgaatgcggcaaatgaaattgctgtggctggctttttaaatggacaggtggctttt
tataatattgaagcacttgttgagaatgcaatgaatcgtcatactagcatttctgaccct
gacttggataccattttacaagtcgatcaagaaacacgcgcgtatgtaaagacactttta
tag

DBGET integrated database retrieval system