KEGG   Listeria monocytogenes 07PF0776: MUO_06915Help
Entry
MUO_06915         CDS       T02040                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUO_06915
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUO_06915
   00052 Galactose metabolism
    MUO_06915
   00500 Starch and sucrose metabolism
    MUO_06915
   00520 Amino sugar and nucleotide sugar metabolism
    MUO_06915
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MUO_06915
   00524 Butirosin and neomycin biosynthesis
    MUO_06915
Enzymes [BR:lmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MUO_06915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1342977..1343945
Genome map
AA seq 322 aa AA seqDB search
MNKKLIGVDLGGTTAKLAILTKEGDIEEKWTIDTNIEEKGAHIVKNIGDSINQKLTDLQL
DNDIFYGIGMGTPGTVNYETGTVKGAYNLGWADEQNVSQDLENITGLKIILDNDANVAAL
GERWKGAGEGGANVVFVTLGTGVGGGIFAEGKILHGIRGAAGEIGHVTVVPENGYDCTCG
KKGCLETVASATGIVRVAKDLAKEYTGKSALKDAINNDETITSKLIFELGAEDDALANET
IDKISFYLALALSHIGNMLNPEKIIIGGGVSAAGDQLLTPVKTYFETMVFPAVKESTKLS
IATKGNDAGIIGAAWLALRSED
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaattaattggtgtagatttaggcgggacaacagcaaaattagctatttta
acaaaagaaggcgacattgaagaaaaatggacaattgatacaaatattgaagaaaagggc
gcccacattgttaaaaacattggggattctatcaatcaaaaattaacggacttacaactg
gataatgatattttttatggtattggtatgggaactccaggtactgtaaattatgaaaca
ggtactgtaaaaggtgcgtacaacttaggctgggcagatgaacaaaatgttagtcaagat
ttagaaaatattactggtttaaaaatcatattagataatgatgctaatgttgccgctctt
ggtgaacgctggaaaggcgcaggcgaaggtggggctaatgtcgttttcgtaacacttgga
acaggcgttggcggcggaattttcgcagaaggcaaaattttacatggtattcgcggagca
gctggtgaaattgggcatgtaacagtagttcctgagaatggttatgattgtacctgtggc
aaaaaaggctgtttagaaactgtcgcatcagcaacaggaatcgttcgagtagcgaaagat
ttagcgaaagagtatactggtaaatccgcacttaaagatgcaataaataacgatgaaaca
attacttctaaattgatttttgaactaggagcagaagatgatgctttagcaaatgaaaca
attgataaaatttctttctatttggctttagcgctcagtcatattggaaacatgttaaat
ccagagaagattattattggtggtggcgtttcagcagcaggcgatcaattattaacaccg
gttaaaacttattttgagacaatggttttcccagctgttaaagaatccactaaattatct
attgcgacaaaagggaatgacgcagggataattggagctgcatggttagcgctacgaagt
gaagattaa

DBGET integrated database retrieval system