KEGG   Listeria monocytogenes 07PF0776: MUO_08000Help
Entry
MUO_08000         CDS       T02040                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MUO_08000
Enzymes [BR:lmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MUO_08000
Exosome [BR:lmp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MUO_08000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1567010..1567984)
Genome map
AA seq 324 aa AA seqDB search
MKNQFDRHRRLRKTKTMRDLVRETVLHTDDLIYPIFVKDGKEPKTEVASMPGVFQYPLHE
LEEEMRVVESLGIKAVILFGIPAEKDAVGTQAYHDHGIIQEATRLIKKSFPEILVVADTC
LCEFTDHGHCGVIENGEILNDESLELLKQTAVSQAAAGADIIAPSNMMDGFVQVIREGLD
EAGFYDIPIMSYAVKYASAFYGPFRDAAGSAPQFGDRKSYQMDPANREEALREAMSDEQE
GADFLIVKPSLSYLDIMRDVKNNTNLPVVAYNVSGEYAMVKAAAQNGWIDEEKIVLEMLT
SMKRAGATLIITYFAKDASKYLNK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaatttgatagacatcgtcgtctaagaaaaaccaaaacaatgcgtgattta
gtaagagaaacagttttacatacagatgatttaatctatccgatttttgttaaagatggc
aaagaaccaaaaacagaagtagcttctatgcctggggtttttcaatatcctttacatgaa
ctagaagaagaaatgcgcgtagttgagagccttggtattaaagcggttattttatttggt
attcctgccgagaaagacgcagttggcacgcaagcttatcacgaccacggaattattcaa
gaagctacaaggcttataaaaaaaagttttcctgaaattcttgtggtggctgacacatgt
ttatgtgaatttactgatcatggacattgtggtgttattgaaaacggggaaattctcaat
gacgaatcgcttgaattattgaaacaaacagctgtcagtcaagccgctgcaggagcggat
atcattgctccatctaatatgatggatggttttgttcaagtcattcgcgaagggttagat
gaagcgggattttatgatatcccaattatgtcatatgcagttaaatatgcgtctgctttt
tatggaccgttccgtgatgctgctggtagtgcccctcaatttggtgatagaaaatcttat
caaatggatcctgccaatcgtgaagaagctcttcgcgaagcaatgtcggatgaacaagaa
ggtgcagatttccttattgttaaaccatcattatcatacttagatatcatgcgcgatgtt
aagaacaataccaatttaccagtagttgcctacaatgttagtggtgaatatgcaatggta
aaagcagctgcgcaaaatggttggatagatgaagaaaaaattgttttagaaatgctaaca
agtatgaaacgagcgggtgcaacacttatcattacttattttgcaaaagatgcatccaaa
tatttaaataaatag

DBGET integrated database retrieval system