KEGG   Listeria monocytogenes 07PF0776: MUO_08085Help
Entry
MUO_08085         CDS       T02040                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUO_08085
   01230 Biosynthesis of amino acids
    MUO_08085
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUO_08085
   00030 Pentose phosphate pathway
    MUO_08085
   00051 Fructose and mannose metabolism
    MUO_08085
   00052 Galactose metabolism
    MUO_08085
  Energy metabolism
   00680 Methane metabolism
    MUO_08085
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MUO_08085
Enzymes [BR:lmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MUO_08085
Protein phosphatases and associated proteins [BR:lmp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MUO_08085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1586739..1587698)
Genome map
AA seq 319 aa AA seqDB search
MKRIAILTSGGDAPGMNAATRAVVRKAIYEGLEVYGINYGFLGLVNGDIRKLELGSVGDL
LHRGGTFLYSARYPEFATEEGQLKGIEQLKKHQIDGLVVIGGDGSYHGAEALTKRGFPTI
GIPGTIDNDISGTDFTIGFDTALNTVLDALDKIRDTATSHERTFIIEVMGRDAGDIALWS
GLAGGAEAIIVPEESFNMDDVVDRLNKGRERGKKHSIIVVAEGVMSGNEFAKQLAEYGDY
HARVTVLGHVQRGGSPTAFDRVLASRLGARSVELLLENRGGLAVGIRENRIVENDISEIL
KEKHTLDQKLFDLASILSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattgcaattttaacaagtggaggagacgctccaggaatgaatgcagccact
cgtgctgttgtacggaaagcaatctatgaaggacttgaagtttacggtattaactatggc
tttttagggctagtcaatggtgatattcgtaaactagaattaggttctgttggtgattta
cttcaccgcggaggtacattcctttattccgcaagatatcctgaattcgctacagaagaa
ggacaacttaaaggaattgaacaattgaaaaaacatcaaatcgatggccttgtggttatt
ggtggagatggttcttatcacggagcggaagcacttacaaaacgtggattcccaactatt
ggtatcccaggaactattgataatgatatttctggaactgattttactattggttttgat
acagcgttaaacactgttcttgatgcacttgataaaatccgcgatacagctacaagtcat
gaacgtactttcattattgaagttatgggtcgtgacgctggtgatatcgctctttggtct
ggacttgctggtggtgctgaagctatcatcgttccagaagaaagttttaatatggatgat
gtcgtggatcgtttgaacaaaggtcgcgaacgtggtaaaaaacatagtattatcgtcgtt
gctgagggcgtaatgtccggtaatgaattcgctaaacaattagctgaatatggcgattat
catgcacgtgtaactgttcttggacacgttcaacgtggtggtagcccaactgcatttgac
cgtgtacttgcaagccgtcttggtgcacgttcagtagaattattgttagaaaaccgcgga
ggattagctgttggaatccgtgaaaatagaattgtcgaaaatgacattagtgaaattttg
aaagaaaaacacacacttgatcaaaaattatttgatctagcatctattttgtcgatttaa

DBGET integrated database retrieval system