KEGG   Listeria monocytogenes 07PF0776: MUO_08365Help
Entry
MUO_08365         CDS       T02040                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
lmp00260  Glycine, serine and threonine metabolism
lmp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmp01100  Metabolic pathways
lmp01110  Biosynthesis of secondary metabolites
lmp01130  Biosynthesis of antibiotics
lmp01230  Biosynthesis of amino acids
Module
lmp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MUO_08365
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MUO_08365
Enzymes [BR:lmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MUO_08365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFH80193
Position
complement(1645874..1647076)
Genome map
AA seq 400 aa AA seqDB search
MTYQAPDENGFYGKFGGRFVPETLMKAVKELDEAYRASKTDPAFQKELNYYLKEYVGRET
PLYFAEQLTAHAGGAKIYLKREDLNHTGAHKINNTIGQALLARQMGKQKVVAETGAGQHG
VATATVAALFNMECTIFMGEEDVKRQSLNVFRMELLGAKVVSVKAGSRTLKDAVNEALRF
WVANVEDTHYIMGSVLGPHPFPEIVRDYQSVIGIEARKQHLEKEGKLPDAIVACVGGGSN
AMGLFYPFVDDVSVQMHGVEAAGHGLETEFHAATISKGEIGILHGAMMDVLQDENGQILE
AFSISAGLDYPGIGPEHSFFRDLGRAAYHSVTDDEAVEAFQLLCRTEGIIPALESSHAIS
YAVKLASQMRPEESMVVCLSGRGDKDVNQLKERLEGQIND
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagcacctgacgaaaatggcttttacggaaaatttggcggcagatttgta
ccagaaacattaatgaaagcagtgaaagaattagacgaggcgtaccgggcttccaaaaca
gatcctgcttttcaaaaagaattaaactattatttaaaagaatatgtgggccgagaaaca
ccactttattttgctgaacaattaacagcacatgcgggcggagcaaaaatttatttaaaa
cgcgaagatttaaatcatactggcgcacataaaatcaataatactattgggcaagcctta
ctcgcacgtcaaatgggtaaacaaaaagtagtggcagaaactggcgcaggacaacacggg
gtggcgactgcaactgttgcagcactttttaatatggaatgtactatttttatgggagaa
gaagatgtgaaacgccaatcactcaatgtgtttagaatggaacttcttggtgcaaaagta
gtgagcgtgaaagcaggaagcagaacattaaaagacgcagtaaatgaggcgctcagattc
tgggttgctaatgtggaagacacgcattacattatgggatccgttcttggaccgcatcca
tttccagaaattgttcgtgattaccaaagtgtgataggaatagaagcacgcaaacaacac
ttggaaaaagaaggtaagcttcctgatgcaattgttgcttgtgttggaggcgggagtaat
gcgatggggttattttatccatttgtagatgatgtttctgttcaaatgcacggtgtggaa
gcagcgggacacggtttagaaactgaattccatgcagcgactatttccaaaggagaaata
gggattttacacggagcgatgatggacgttttacaagatgagaatggacaaattttggaa
gcattttcgatttcagctggcttagattatccaggtattggtccggagcatagctttttc
cgtgatttaggtcgtgcagcgtaccattctgttaccgatgatgaagccgttgaagcattt
caacttttatgtcgtacggaaggaatcattcctgcactcgaaagctcgcacgcgattagt
tatgcagtcaaacttgcaagccaaatgcgtccagaagaaagtatggtcgtttgtttatct
ggtcgcggagataaagatgttaatcaactaaaggaacgcttggagggacaaataaatgac
taa

DBGET integrated database retrieval system