KEGG   Listeria monocytogenes 07PF0776: MUO_08375Help
Entry
MUO_08375         CDS       T02040                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
lmp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lmp01100  Metabolic pathways
lmp01110  Biosynthesis of secondary metabolites
lmp01130  Biosynthesis of antibiotics
lmp01230  Biosynthesis of amino acids
Module
lmp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MUO_08375 (trpC)
Enzymes [BR:lmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MUO_08375 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AFH80195
Position
complement(1647684..1648442)
Genome map
AA seq 252 aa AA seqDB search
MTFLEEILAQKAVEVADMPLEKVAEKRKTYSFYEFLKANTSTMQLIAEVKRASPSKGEIN
MGVNPVLQAKSYQAAGAGMISVLTDPVFFKGSIEDLREVAKNVEIPVLCKDFIISEKQLI
RARNAGATVVLLIISALTEEMLIALFEQALALDLEVLVEVHDQKELAVAQKIGAKLIGVN
NRNLHTFEVDIAVSERLASDFSSDACFISESGFRTAEDVARVSQKYNAVLVGEALMREAT
PEAAAKSLKVTR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacatttttagaagaaattttagcgcaaaaagcagtagaagttgcagacatgccctta
gaaaaagtagccgaaaaacggaaaacttattcgttttatgaatttttaaaagcaaatacc
agcacgatgcaacttattgcagaagtaaaacgcgcctctccttctaaaggggaaatcaat
atgggcgtgaatccggttctgcaagccaagtcttatcaagctgcgggtgcaggaatgatt
tctgttttgacagatcctgtttttttcaaaggctcgattgaagatttgcgagaagtagcg
aaaaatgtcgaaattcctgtactatgtaaagattttattattagtgaaaaacaattgatt
cgtgctcgaaatgcgggagcaacggttgtattgctaattatttcggcacttacagaagag
atgctaattgctctgtttgaacaagctctggcgcttgatttggaagtgttagtggaagta
catgaccagaaagaattagctgttgctcaaaaaattggagctaaactcattggtgtgaac
aaccgtaatttgcatacatttgaagtggatattgcagtaagtgaaagactggcgagcgat
ttctcgtcggatgcttgtttcataagtgaatcaggttttcgaacagctgaagatgtggct
cgggttagtcaaaaatataatgcagtacttgttggagaagcgctaatgcgagaagcgact
ccagaagcagcggcgaaaagtttgaaggtgacacgatga

DBGET integrated database retrieval system