KEGG   Listeria monocytogenes 07PF0776: MUO_08555Help
Entry
MUO_08555         CDS       T02040                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lmp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1690978..1692843)
Genome map
AA seq 621 aa AA seqDB search
MCGFVGCVHDRITEITGADKETFRQMNSMITHRGPDDEGYFTDDHVQFGFRRLSIIDVAN
GHQPLTYENERYWIIFNGEVYNYVELREQLVAEGMTFETESDTEVIIATYAKYKEKTAER
LRGMFGFVIWDKQEELVYGARDPFGIKPFFYAEEDGKLFMGSEKKSILHALKEKELDEVS
LQNYMTYQFVPEPDSLTKNVKRLEPGHQFTKKIGQPMEITTYWKASFAPVTKSEDAWIKE
VRDVMYDSVKMHMRSDVPVGSFLSGGIDSSIIAAIAKEYHPAIKTFSVGFERDGFSEIDV
AKETADKLGVENISYVISPEEYMKELPKIVWHMDDPLADPAAIPLYFLSREARKQVTVAL
SGEGADELFGGYNIYNEPNSLAMFNKMPSVFKSMLNSVARIMPEGMRGKSFLERGTTPME
ERYIGNAKMFTEKEKQILLPKYQAGHDYTNITDPFYAETTNYHPVERMQYIDIHTWLRGD
ILLKADRMTMANSLEVRVPFLDKEVYNVARNIPDTMKTTNGTTKYILRKAAATFVPEHVL
NRRKLGFPVPIRHWLKDEMNAWVKNIIKESPTDHLINKQYVLGLLDDHCAGKFDYSRKIW
TVVIFMIWYDVYVADKYDFGK
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttgtaggatgcgtacatgaccgcattacagaaattactggcgctgataaa
gaaacctttagacaaatgaacagtatgattacgcaccgtgggccagatgatgaaggatac
ttcacagatgatcacgtgcagtttggtttccgccgtttaagtattattgatgtagcaaac
ggtcatcaaccgttaacgtatgaaaatgaacgttactggattatttttaatggagaagtt
tataactatgtggaactccgtgagcaattagttgctgaaggaatgacatttgaaaccgaa
agtgataccgaagtaattatcgctacatatgcgaaatacaaagaaaaaacagcagaacgt
cttcgtgggatgtttggtttcgttatttgggataaacaagaagaacttgtttacggcgca
cgcgacccatttggcattaaaccatttttctatgcagaagaagatggcaaattgttcatg
ggttctgaaaagaaatccattctacatgctttaaaagaaaaagaattggatgaagtttca
ttacaaaactatatgacttaccaattcgttccagaaccagattccttaactaaaaatgta
aaacgtttagaaccaggacatcagttcacgaagaaaattggtcaaccaatggaaattact
acttattggaaagcatcttttgcaccagtaactaaatcagaagacgcatggattaaagaa
gtgcgtgacgtgatgtatgattctgtaaaaatgcatatgcgctctgatgtaccagttggt
tcattcctatctggtggtattgattcatcgattattgctgcgattgctaaagaatatcat
cctgcaatcaaaacattctctgttggttttgaacgcgatggtttcagtgaaatcgatgtc
gcaaaagaaacagcagacaaacttggcgtagaaaacattagttatgttatctcacctgaa
gaatatatgaaagaattaccaaaaattgtttggcatatggatgatccacttgctgatcca
gctgctattccgctttacttcttatcaagagaagcgcgcaaacaagtaacggttgcattg
tccggtgaaggtgcagatgaacttttcggtggttataacatttataacgaaccgaattcc
cttgcgatgtttaacaaaatgccaagcgtatttaaatcaatgctaaatagcgtggcgcgc
attatgccagaaggtatgcgtggtaaaagtttcttagaacgtggaaccactccgatggaa
gaacgctatatcggaaacgccaaaatgttcacggaaaaagaaaaacaaattttacttcca
aaatatcaagctggtcatgactatacgaacattacagatccattttatgcagaaacaacg
aattatcatcctgtagaaagaatgcagtacattgatattcatacgtggcttcgcggagat
attcttctcaaagctgaccgcatgacgatggctaattcgctggaagtccgtgtacctttc
cttgataaagaagtgtacaatgtggcaagaaatattccagatacaatgaaaacaaccaat
ggaacaaccaaatatatcttacgtaaagcggcagcaacatttgtaccagaacacgtactt
aaccgccgtaaactaggattcccagtaccaattcgtcactggttaaaagacgaaatgaac
gcttgggttaaaaacatcattaaagaatcaccaacagatcatttaattaacaaacaatac
gttctaggattactagacgatcactgtgccggtaaattcgactacagtcgtaaaatctgg
acagttgttattttcatgatttggtatgatgtatacgtagcagataaatacgattttgga
aaataa

DBGET integrated database retrieval system