KEGG   Listeria monocytogenes 07PF0776: MUO_12230Help
Entry
MUO_12230         CDS       T02040                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lmp  Listeria monocytogenes 07PF0776
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2474378..2475124)
Genome map
AA seq 248 aa AA seqDB search
MKITPPQPFLFEKGKRAVLLLHGFTGSSADVRILGRFLQENDYTCYAPQYRGHGVSPDLL
LKTGPNDWWEDVLEAYDHLKSLGYTEIAVAGLSLGGLFSLKLGFSRPLKGIIAMSTPTRM
DSSSPIIQGFLDYVRNYKKLEGKTPEQIDAEMVAYKDAPMNTIAKLKDEINGVVAEIDMI
YAPIMVVQGEKDDMVDVSGAQLIYDTVESTKKELHWFKESGHVITLDKERKEVNQAILTF
LDSLDWQE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataacaccaccacaaccattcctattcgaaaaaggcaaaagagcagtgttactc
ttacacggtttcacaggtagctcagcggatgtaagaatattaggtaggtttttacaagaa
aacgattatacttgctatgcgcctcaatacagaggccacggtgtatctcctgacctactg
ttaaaaacgggaccaaacgattggtgggaagatgttcttgaagcctatgatcacctaaaa
tcactcggttacacggaaatcgctgtagcgggactttcgctaggtggacttttttcacta
aaattaggtttttctaggccgttaaagggaattatagccatgagtactccaacaagaatg
gacagttcatcaccaataattcaaggctttttagattatgtgcgtaattataaaaaatta
gaaggtaaaacacctgaacaaatcgatgctgaaatggttgcctataaagacgccccaatg
aacacaatcgctaaactaaaggacgagataaatggcgtcgtggctgaaatagatatgatt
tatgcgccaataatggtcgtccaaggtgaaaaagacgatatggttgatgtgagcggagca
cagctaatttatgatacagtagagtcaacgaagaaagaattgcactggtttaaagaatct
gggcacgtcatcacattagacaaagaacgaaaagaagtaaatcaagccattttaacattt
ttagatagtttagattggcaagaatag

DBGET integrated database retrieval system