KEGG   Listeria monocytogenes 07PF0776: MUO_12840Help
Entry
MUO_12840         CDS       T02040                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MUO_12840
Enzymes [BR:lmp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MUO_12840
    3.5.1.-  
     MUO_12840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2599760..2600392)
Genome map
AA seq 210 aa AA seqDB search
MKIAAFDIDAQKGFTPLCPDELPVSGGDKIVPELNFMASLASLRIGSKDAHPQNAVWVVD
SKDEMLAELEYPNADRTWVRHCEPGTKGFELLDGLPVVTDYDYFIWKGMEPDIHPYGACY
HDIVEQLSTGVLEYLREQKVDLVLVGGLAFDFCVKTTVIQLSRAGFSVLVYLPATRALSE
QGFDETKEQLANTEKVQLIETREELVAYCQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgctgcttttgatattgatgcacaaaaaggttttacgccgctttgtcccgat
gaattaccggtttcgggcggagacaaaattgtgccagaacttaattttatggcaagtctt
gcttctcttcgaattggtagtaaggacgcccatccgcaaaatgccgtatgggtagtggat
tccaaagacgaaatgttggctgaactcgaatatccaaatgcagaccgtacttgggtaagg
cactgtgaaccaggtacaaaaggttttgaattattagatggtttaccagttgtgactgat
tatgattactttatttggaaaggtatggagccggatattcatccgtacggcgcttgttac
cacgatattgttgaacagctttcaacaggtgttctagaatatttacgggaacaaaaagtc
gatttagttcttgttggaggtttagcttttgatttttgtgtgaaaactacggttatacag
ttaagtagggcaggcttttctgtattagtttatttaccagcgacacgtgcactatctgaa
caaggttttgatgaaacgaaagagcaattagcaaataccgagaaagtgcaacttatcgaa
acaagggaggaacttgtcgcctattgccagtaa

DBGET integrated database retrieval system