KEGG   Listeria monocytogenes 07PF0776: MUO_13620Help
Entry
MUO_13620         CDS       T02040                                 

Definition
(GenBank) acetate-CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
lmp00010  Glycolysis / Gluconeogenesis
lmp00620  Pyruvate metabolism
lmp00640  Propanoate metabolism
lmp00680  Methane metabolism
lmp01100  Metabolic pathways
lmp01110  Biosynthesis of secondary metabolites
lmp01120  Microbial metabolism in diverse environments
lmp01130  Biosynthesis of antibiotics
lmp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUO_13620
   00620 Pyruvate metabolism
    MUO_13620
   00640 Propanoate metabolism
    MUO_13620
  Energy metabolism
   00680 Methane metabolism
    MUO_13620
Enzymes [BR:lmp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MUO_13620
Lipid biosynthesis proteins [BR:lmp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MUO_13620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFH81240
Position
2744262..2745839
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHNETKTWSYRHLLEQANKFANVVKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGEKLSGWDHYETLMEAASTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLHLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDAEGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTEDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattaccgacgagattgctaaa
ttcagttctgaaaaaactgctttaatttggaaaaatgagcataacgaaacaaaaacttgg
agttaccgccacctgcttgaacaagcgaataaatttgccaatgttgtcaaagacgcaggc
ataaaaaaaggtgaccacgttatcgtcatgacacctagattactcgaaacgtacgcaatt
tacatgggcttatggaaagctggtgccattatcatcccggcatccgagctacttaaagcg
cacgatttagaataccgcatccaccatgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaattattgtt
ggggagaaattatccggctgggatcactacgaaacattaatggaagccgcttcaaccgaa
tttgaacgcgtggaaacttcgcgcgatgatgcttgtctgcttgcattcacgagtggaaca
acaggtaatcctaaaggcgttgtacatattcacggctggggttacgcgcatattcgtatc
gctgctgaccattggctcgatattcacgaagacgatatcgtttgggccacagctggtcct
ggttggcaaaaatgggtttggtctcctttcctttctgtactcggaaaaggtgccactggc
ttcatttacaacggtcgtttcattcctgaaaaacaacttcatttactggaagaagaaaaa
atcaacgtgctgtgctgtacgccaacagaatatcgcttaatggctaaagtaaataatttg
cgcgaacatgatttaagttcccttcgtagcgccgtatcagcaggagaacctctaaaccgc
gaagtaattcaagttttccaagataattttgatattaaagttcgcgacggctacggtcaa
acggagagtacactgttgattgggacactggttgatacgccgattcgccctggttcgatg
ggtaaaccgattatgccagaatacatggcaattattgacgctgaaggaaatccagttggt
gtcggtgaaattggtgatatcgcgatgcgtagagatttcccagcacttttcaaagagtac
tataaagaaccagaacgtttgcaaaaagcgattcgcggtgattatttcgtttctggtgac
cgcgctatccgcgatgaagataattattactggttccaaggccggaatgacgatattatt
attagctctggttacacgattggaccgttcgaagtagaggacgcgctcacacatcatcca
gccgtaaaagaagtcgctgttgtcgcaagtcctgacgaaatccgcggtacggtcgtaaaa
gcatttatcgtcttaaaggatggttacgagggcacggaagatcttgtgcatgaattacaa
acattcacgaaagaacaaaccgctccgtataagtatccgcgccggattgagtttgttgag
gcattaccgaaaactgattctggtaaaattcgtcgcgttgagttgcgtgatgcggagttt
gctagtgtgcatggatga

DBGET integrated database retrieval system