KEGG   Listeria monocytogenes 07PF0776: MUO_13620Help
Entry
MUO_13620         CDS       T02040                                 

Definition
acetate-CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MUO_13620
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUO_13620
   00620 Pyruvate metabolism
    MUO_13620
   00640 Propanoate metabolism
    MUO_13620
  Energy metabolism
   00680 Methane metabolism
    MUO_13620
Enzymes [BR:lmp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MUO_13620
Lipid biosynthesis proteins [BR:lmp01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MUO_13620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2744262..2745839
Genome map
AA seq 525 aa AA seqDB search
MNSENLIAPELYNITDEIAKFSSEKTALIWKNEHNETKTWSYRHLLEQANKFANVVKDAG
IKKGDHVIVMTPRLLETYAIYMGLWKAGAIIIPASELLKAHDLEYRIHHANVKAIVSYNG
MTAEFDKIESIPSVSKKIIVGEKLSGWDHYETLMEAASTEFERVETSRDDACLLAFTSGT
TGNPKGVVHIHGWGYAHIRIAADHWLDIHEDDIVWATAGPGWQKWVWSPFLSVLGKGATG
FIYNGRFIPEKQLHLLEEEKINVLCCTPTEYRLMAKVNNLREHDLSSLRSAVSAGEPLNR
EVIQVFQDNFDIKVRDGYGQTESTLLIGTLVDTPIRPGSMGKPIMPEYMAIIDAEGNPVG
VGEIGDIAMRRDFPALFKEYYKEPERLQKAIRGDYFVSGDRAIRDEDNYYWFQGRNDDII
ISSGYTIGPFEVEDALTHHPAVKEVAVVASPDEIRGTVVKAFIVLKDGYEGTEDLVHELQ
TFTKEQTAPYKYPRRIEFVEALPKTDSGKIRRVELRDAEFASVHG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagaaaatttaatcgctccagaactttataatattaccgacgagattgctaaa
ttcagttctgaaaaaactgctttaatttggaaaaatgagcataacgaaacaaaaacttgg
agttaccgccacctgcttgaacaagcgaataaatttgccaatgttgtcaaagacgcaggc
ataaaaaaaggtgaccacgttatcgtcatgacacctagattactcgaaacgtacgcaatt
tacatgggcttatggaaagctggtgccattatcatcccggcatccgagctacttaaagcg
cacgatttagaataccgcatccaccatgcaaacgtaaaagcaatcgtttcttacaatgga
atgactgctgaatttgataaaattgaaagcatcccttctgtttcgaaaaaaattattgtt
ggggagaaattatccggctgggatcactacgaaacattaatggaagccgcttcaaccgaa
tttgaacgcgtggaaacttcgcgcgatgatgcttgtctgcttgcattcacgagtggaaca
acaggtaatcctaaaggcgttgtacatattcacggctggggttacgcgcatattcgtatc
gctgctgaccattggctcgatattcacgaagacgatatcgtttgggccacagctggtcct
ggttggcaaaaatgggtttggtctcctttcctttctgtactcggaaaaggtgccactggc
ttcatttacaacggtcgtttcattcctgaaaaacaacttcatttactggaagaagaaaaa
atcaacgtgctgtgctgtacgccaacagaatatcgcttaatggctaaagtaaataatttg
cgcgaacatgatttaagttcccttcgtagcgccgtatcagcaggagaacctctaaaccgc
gaagtaattcaagttttccaagataattttgatattaaagttcgcgacggctacggtcaa
acggagagtacactgttgattgggacactggttgatacgccgattcgccctggttcgatg
ggtaaaccgattatgccagaatacatggcaattattgacgctgaaggaaatccagttggt
gtcggtgaaattggtgatatcgcgatgcgtagagatttcccagcacttttcaaagagtac
tataaagaaccagaacgtttgcaaaaagcgattcgcggtgattatttcgtttctggtgac
cgcgctatccgcgatgaagataattattactggttccaaggccggaatgacgatattatt
attagctctggttacacgattggaccgttcgaagtagaggacgcgctcacacatcatcca
gccgtaaaagaagtcgctgttgtcgcaagtcctgacgaaatccgcggtacggtcgtaaaa
gcatttatcgtcttaaaggatggttacgagggcacggaagatcttgtgcatgaattacaa
acattcacgaaagaacaaaccgctccgtataagtatccgcgccggattgagtttgttgag
gcattaccgaaaactgattctggtaaaattcgtcgcgttgagttgcgtgatgcggagttt
gctagtgtgcatggatga

DBGET integrated database retrieval system