KEGG   Listeria monocytogenes 07PF0776: MUO_13735Help
Entry
MUO_13735         CDS       T02040                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MUO_13735
Enzymes [BR:lmp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     MUO_13735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2764612..2766294
Genome map
AA seq 560 aa AA seqDB search
MQTELVNQIEVKLRKIYQAAYQPAYLEKMLACAENYSNNARGSIDTISEKNVYLIAYGDS
IFEKNKHPLQTLNEFLQEYAQDVITDVHLLPIFPSTSDDGFSVTDYKQIDEQLGDWDDVQ
KMSENFRVMLDFVANHMSKSSDWFKRFSDNEAPYNQFFIEKDSQFDYKNVTRPRTSPLFH
KYENGKELWTTFSEDQLDLNVRNIDCLVALTDVLLFYASKQATSIRLDAIGFLWKTSGTT
CMHLPETHEIITLWRLLIDELYPNLQIITETNVPHEENISYFGDGENEANMVYQFPLPPL
VLHTFTCHDTTKLSKWAKSISQVSSTATYFNFLASHDGIGMRPATGILSDEEINSLVQKA
VQNGGQVSYKDNADGTQSVYELNINYGEALQNPGEDTTEELVTKKIIAAHSILLTLQGVP
AIYYHSLLGSKNDLVGYEESGINRRINREKLEKNQLVHELETDTYRQTIFTSLKKLVQIR
RNHTAFSPFATQEILDLGPDVFAIKRESEEECIYGIINVTSHNIRKTLAFSGTNLLTNQP
VTSELDLTAYEVVWIKKAVQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgaactggttaatcaaatagaagtaaaactaagaaaaatttatcaagctgca
taccaacccgcatacttggaaaaaatgctcgcatgcgccgaaaactattctaataatgcg
cgtggttcgattgatactatttccgaaaaaaacgtctatcttattgcctatggcgacagc
attttcgaaaaaaacaagcatccgttacaaacattgaatgaattcctacaagaatatgcg
caagatgttattacagatgtccacttgctgccgattttccctagtacgtcagatgatggc
ttctctgtcacagactacaagcaaattgacgaacagcttggcgactgggatgacgttcaa
aaaatgtctgagaacttccgagtgatgcttgatttcgtagccaatcatatgtcgaaatca
agtgattggtttaagcgattctccgataacgaagcgccgtacaatcaatttttcatcgag
aaggacagccaatttgattataaaaacgtcacacgtccgcggacttctccgctgttccac
aaatacgaaaacggtaaagaactttggactacttttagcgaagatcagttagacttaaat
gtccgtaatatcgattgccttgtagccttaacagatgtactgcttttctatgcatccaaa
caagcgacaagcattcgacttgatgccattggatttttatggaaaacttctggcactact
tgtatgcacctgccagaaacccatgagatcatcacgctttggcgtctgctgattgatgaa
ctatatccaaatctgcaaattatcacagaaacaaacgtccctcatgaagaaaacattagt
tattttggcgatggtgaaaatgaagcaaatatggtttatcagttcccgcttccgccactt
gtgctccataccttcacttgccatgatacaacgaaactttcgaagtgggcgaaatccatt
tcacaagtttctagcacagcgacttattttaacttcttagcaagtcatgacggaattggt
atgcgccctgcgaccggaattctttccgacgaagaaatcaattctctcgtccaaaaagcg
gtccaaaacggtggccaagtttcctataaagacaacgcagatggcacgcagtcggtatac
gaacttaatattaactacggtgaagccctgcaaaacccgggcgaagacacaactgaagaa
ctcgtaacgaaaaaaattatcgctgctcatagtattttgctaacacttcaaggcgtccca
gcgatttactatcattcccttctaggttctaaaaacgaccttgttggttacgaagaatcc
ggtattaatcgccgcatcaatcgtgaaaaactggaaaaaaatcaattggttcatgaactt
gaaacagacacttatcgccaaaccattttcacatcgctgaaaaaattggtgcaaatcaga
cgaaatcacaccgctttttcaccatttgcaacccaagaaattttagatttaggaccagat
gtttttgcgataaaacgggaatctgaggaagaatgtatttacggaattatcaacgtcact
tctcataatatccgcaaaacgctcgctttctctggcacgaatctattaaccaatcaaccc
gttacgagtgaacttgatttaactgcgtatgaagttgtctggattaagaaggcggtccaa
tga

DBGET integrated database retrieval system