KEGG   Listeria monocytogenes 07PF0776: MUO_13920Help
Entry
MUO_13920         CDS       T02040                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmp  Listeria monocytogenes 07PF0776
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MUO_13920
Enzymes [BR:lmp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     MUO_13920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2810028..2811476)
Genome map
AA seq 482 aa AA seqDB search
MSNTKFPDGFMWGGATAANQFEGGYNSGGKGLACADLFTGGTHTEPRRITAQLEESTFYP
SHEAVDFYHHYKEDIKLMAEAGFKVFRMSINWTRIFPTGKEAEPNEEGLQFYEDVFMELK
KYQIEPLVTIAHFDIPLALTNEVNGWASRDLIDYYLHYCEVIFKRYKHLVKHWLTFNEIN
TATMEIGNYLSLGIRHAEGDFLHQKDDPTVRYQALHHQFVASAKAVKLGHSINPEFMIGC
MIAYMPRYPRTCEPTDVLLAKQTEAMHSHFCGDVHVKGYYPFYAKTFFKDKGIELEFDPE
DEQVLREGTVDFYTFSYYLTLCASNDPAYKNSGKSVIGGAENPYLKTNDWGMQTDPVGLR
IALNDLYTRYNIPLMVVENGLGAFDKLEDDGTINDPYRIDYFKEHILQMHKAIQDGVDLI
GFTIWGCIDLVSASTGEMAKRYGIIYVDKYDDGTGDYSRKKKASYYWYKDVISSNGEIGL
RE
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatacgaagtttccagatggctttatgtggggcggggcgaccgcggctaaccag
tttgaaggtggttataattcaggcggaaaagggcttgcctgtgcggatttattcactggt
ggaacgcatacagagccaagaagaattaccgcacaattagaagaatccactttttatcca
agtcatgaagcagtggacttttatcatcattataaagaggatattaagttaatggcagaa
gctggatttaaagtgttccggatgtccataaactggactcgtattttcccgacaggaaag
gaagcagagcctaacgaggaaggattgcagttttatgaagatgtttttatggagctgaaa
aaatatcagattgaaccgttagtgacgattgctcattttgatattccgctagcattaacg
aatgaggtgaacggctgggcgtcgcgtgatttgattgattactatcttcattattgtgaa
gtgatttttaaacgctataaacatttagtaaaacactggttgacgttcaatgaaataaat
actgcaacaatggaaattgggaattatttatcccttggcattcgtcatgcggagggagat
ttccttcatcaaaaagatgacccaacagtgagatatcaagcccttcatcatcaatttgtt
gctagtgcaaaagcggtaaaactaggccatagcatcaacccagaattcatgattggctgc
atgattgcttatatgccacgctacccgcgtacttgcgaaccaactgatgtcttgctggct
aagcaaacggaagcaatgcacagccatttctgcggcgacgttcatgtcaaagggtattat
cctttttatgcaaaaacattctttaaagataagggtattgagcttgaatttgacccagaa
gatgaacaagttttgcgagaaggcacggttgatttttatacttttagctattatttaacg
ctttgtgcatccaacgatcctgcctataaaaattcgggaaaaagtgttattggaggggct
gaaaatccttatttaaaaacaaatgattggggaatgcagacagatcctgtagggcttcgg
attgcactgaatgatttatatactcgctataatattccgcttatggtagttgaaaatggt
ttaggagcctttgataaattggaagacgatgggacgattaatgatccgtatcgaattgat
tatttcaaagaacatattcttcaaatgcataaagcaattcaagatggtgtagatttgatt
ggatttactatttggggttgtattgacctagtgagcgcatctacaggggaaatggccaaa
cgttatggtattatttatgtggataaatacgatgatggaaccggtgattattcgcgtaaa
aagaaagcatcctattattggtataaagatgtgattagttcaaatggtgaaattggattg
agagagtaa

DBGET integrated database retrieval system