KEGG   Listeria monocytogenes M7: LMM7_0018Help
Entry
LMM7_0018         CDS       T01988                                 

Definition
beta-glucosidase (Cellobiase)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmq  Listeria monocytogenes M7
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lmq00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20426..21859
Genome map
AA seq 477 aa AA seqDB search
MTESKFPKGFLWGGAVAANQCEGAYLEDGKGLSLVDILPTVEDGRWEALFNPSKALATDY
GFYPSHESIDFYHRYKEDIKLMAEMGFKCFRMSISWPRIFPNGDETTPNEKGLAFYDAVF
DECHKYGIEPVVTINHFDTPLEVFKKYGGWKNRKCIDFYLNFCEAIFTRYKDKVKYWMTF
NEINMILHLPYIGGGLDVTKEANPEEVKYQAAHHQLVASALATKLGHEINPENQIGCMLA
AGNTYPMTCNPKDVWKSIEADREGYFFIDVQARGYYPSYTKRFFKEHNINIKMEDGDLDA
LRDHTVDYVAFSYYSSRLTSADPEKNKETEGNVFATLKNPYLKASEWGWQIDPLGLRITM
NTIYDRYQKPLFIVENGLGAVDTVAEDGSITDDYRIDYMREHVREMGEAIEDGVELLGYT
PWGCIDLVSAGSGEMKKRYGFIYVDRDNKGNGTLNRSKKKSFDWYKKVIETNGKDID
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacagaatcaaaatttcctaaaggcttcttatggggcggagcagttgctgccaaccaa
tgtgagggagcttatcttgaagacggtaaaggactttcacttgttgacatccttccaaca
gtagaggatggacgttgggaagctttattcaatccatcgaaagcgcttgctacagattat
ggtttttatccaagtcacgaatcaattgatttttatcatcgttataaagaagacattaaa
ttaatggcagaaatgggattcaagtgtttccgtatgtccatcagctggccacgtattttc
ccgaatggtgacgaaacgacaccaaatgaaaaaggtttagcattttatgatgcagttttt
gatgaatgtcataaatatggcatcgaaccagttgttacaatcaaccattttgatactccg
ctagaagttttcaaaaaatatggcggttggaaaaatcgtaaatgtatcgacttttactta
aatttctgtgaagcaattttcacgcgttataaagataaagtaaaatattggatgacattt
aatgaaatcaacatgattcttcatctgccatacattggtggaggtttagacgttactaaa
gaagctaatccagaggaagttaaatatcaagctgctcatcatcaattagttgcatctgct
ttagcgacaaaacttggtcatgaaatcaaccctgaaaatcaaatcggttgtatgcttgca
gcgggtaacacgtatccaatgacttgtaatccaaaagatgtctggaaatctatcgaggca
gaccgtgaaggctacttcttcattgacgttcaagcgcgcggatactacccaagctacact
aaacgtttcttcaaagaacacaacatcaacattaaaatggaagatggcgacttagacgca
ttacgcgatcacacagttgattacgtggcattcagctactattcttctcgtctaacaagc
gcagatccagagaaaaacaaagaaacagaaggcaacgttttcgcaacactaaaaaaccca
tacctaaaagcaagcgaatggggttggcaaattgatccactaggtctacgtattactatg
aatacaatttacgaccgttaccaaaaacctcttttcatcgttgaaaatggcttaggtgca
gtggatactgtggcagaagacggctcaatcactgacgattacagaatcgactacatgcgt
gaacacgttcgcgaaatgggcgaagcaatcgaggacggcgtggaacttcttggttataca
ccatggggctgcatcgaccttgtcagcgctggctctggcgaaatgaaaaaacgctacggc
ttcatctacgttgaccgcgacaacaaaggcaacggaaccctaaaccgctcgaagaaaaaa
tcattcgactggtacaaaaaagtaattgaaacaaatggtaaagatatcgactag

DBGET integrated database retrieval system