KEGG   Listeria monocytogenes M7: LMM7_0211Help
Entry
LMM7_0211         CDS       T01988                                 

Gene name
iapE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lmq  Listeria monocytogenes M7
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMM7_0211 (iapE)
Enzymes [BR:lmq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LMM7_0211 (iapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213197..214072
Genome map
AA seq 291 aa AA seqDB search
MKISITAPAKINLSLDALYKRDDGYHEVEMVMTTIDLADRLYLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSSDAAAALKGLNIIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNMPGCWIVLAKPSISVSTPTI
YKELQVESVEHPDTKKMIESIKNGDLDGIFASTGNVLESVTLEKNPQVKRIKDRMLAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSEGENDTNK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcataacagcaccagctaaaattaatctttcacttgatgcgctgtacaaa
cgtgatgatggctatcatgaagtggaaatggtgatgacaacaattgatcttgctgacagg
ttatacttagaacgcttagatgaagataaaattgtgctagatgtaaaagcgcactttatt
ccagaagatcgtcgtaacttaatttatcaagcggctcttcttttaaaaaagcgttttgac
gtaaagatgggtgtgcgcattacaattgataagcacattcctgtttctgcggggcttgct
ggtggtagttcagatgcggcggcagcgctcaaaggcttgaatattatttgggaacttggt
ctttcaatagaagaattagctgaaattagttcagaaatcggttctgatatcgcgttttgc
gtatacggaggaacagcactagcaacgggacgtggtgaaaaaatttctgcgttacctaat
atgcctggttgctggattgtgctagctaaaccgagcatcagcgtatcaacaccaaccatc
tataaagaacttcaagtagaaagtgtagaacacccagacactaaaaaaatgattgaatcc
atcaaaaatggtgatttagacggaatttttgcgtcgactggtaatgtgctagaatcggtg
acattagaaaaaaatccacaagttaaacgaataaaagatcggatgttagcgtttggtgct
gaggcggctcttatgagtggtagcgggccgacagtgtttgcgctcatcaaacagtactcc
agagcaaaacgtgtctataacggcttgcgtggcttttgtgaggaagtctatatggttaga
ccgtggagtgaaggcgagaacgatacaaataaataa

DBGET integrated database retrieval system