KEGG   Listeria monocytogenes M7: LMM7_0211Help
Entry
LMM7_0211         CDS       T01988                                 

Gene name
iapE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lmq  Listeria monocytogenes M7
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lmq00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
213197..214072
Genome map
AA seq 291 aa AA seqDB search
MKISITAPAKINLSLDALYKRDDGYHEVEMVMTTIDLADRLYLERLDEDKIVLDVKAHFI
PEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSSDAAAALKGLNIIWELG
LSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNMPGCWIVLAKPSISVSTPTI
YKELQVESVEHPDTKKMIESIKNGDLDGIFASTGNVLESVTLEKNPQVKRIKDRMLAFGA
EAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRPWSEGENDTNK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagcataacagcaccagctaaaattaatctttcacttgatgcgctgtacaaa
cgtgatgatggctatcatgaagtggaaatggtgatgacaacaattgatcttgctgacagg
ttatacttagaacgcttagatgaagataaaattgtgctagatgtaaaagcgcactttatt
ccagaagatcgtcgtaacttaatttatcaagcggctcttcttttaaaaaagcgttttgac
gtaaagatgggtgtgcgcattacaattgataagcacattcctgtttctgcggggcttgct
ggtggtagttcagatgcggcggcagcgctcaaaggcttgaatattatttgggaacttggt
ctttcaatagaagaattagctgaaattagttcagaaatcggttctgatatcgcgttttgc
gtatacggaggaacagcactagcaacgggacgtggtgaaaaaatttctgcgttacctaat
atgcctggttgctggattgtgctagctaaaccgagcatcagcgtatcaacaccaaccatc
tataaagaacttcaagtagaaagtgtagaacacccagacactaaaaaaatgattgaatcc
atcaaaaatggtgatttagacggaatttttgcgtcgactggtaatgtgctagaatcggtg
acattagaaaaaaatccacaagttaaacgaataaaagatcggatgttagcgtttggtgct
gaggcggctcttatgagtggtagcgggccgacagtgtttgcgctcatcaaacagtactcc
agagcaaaacgtgtctataacggcttgcgtggcttttgtgaggaagtctatatggttaga
ccgtggagtgaaggcgagaacgatacaaataaataa

DBGET integrated database retrieval system