KEGG   Listeria monocytogenes M7: LMM7_0246Help
Entry
LMM7_0246         CDS       T01988                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lmq  Listeria monocytogenes M7
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LMM7_0246 (folP)
Enzymes [BR:lmq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LMM7_0246 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
251785..252570
Genome map
AA seq 261 aa AA seqDB search
MVMGILNVTPDSFSDGGKYMQVEEAVNRALQMAEDGAAIIDVGGISTRPGFSEVTPEEEL
TRIIPVIKAVRTKLPDIWISVDTWRAEVAEKAILAGANMINDQWGAKKEPKIAEVAAKYN
VPICLMHNRENTQYDNFLEDVKKDLLESVAIAKAASVPDEHIILDPGFGFVKTPAQNLEV
LRRIDEIVALGYEVLLGTSRKSTIGLVLGTTPEDRMEGTGATTVYGFSKGCTITRVHDVL
PIARMVRMTDAITGKLDITKL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggggatactgaatgttacgccagactctttttcggatggcgggaaatatatg
caagtggaagaagcggtgaatcgagcgttgcaaatggcagaagacggagcggcgatcatt
gacgttggtgggatatctactcggcctggtttttcagaggtaacacctgaggaagaactt
actagaattattcctgtcattaaagctgttaggacaaaacttccggatatatggatttct
gttgatacttggcgtgccgaagtggctgaaaaagctattttagcaggagctaatatgata
aatgatcaatggggtgccaaaaaagaaccaaaaattgcggaagtagctgcgaaatataac
gtgccaatttgtttgatgcacaaccgagaaaacacgcaatacgataattttctggaagat
gtgaagaaagacttattagaaagtgttgcaattgctaaagcggcatccgtgccagatgaa
catattattcttgatccgggtttcggttttgttaagacacctgcgcagaatttagaagtg
ttacgacgcattgatgagatagtggcgcttggttacgaggttttacttggtacgagtaga
aagtcgacaattggtctcgtcttaggaactactcccgaggatagaatggaaggaactgga
gcgacaaccgtttacggattttcgaaaggttgcacaattactcgtgtacacgatgtactt
ccaattgcgcgcatggtaagaatgacagacgcgattactggcaaattagatattacaaaa
ttataa

DBGET integrated database retrieval system