KEGG   Listeria monocytogenes M7: LMM7_0349Help
Entry
LMM7_0349         CDS       T01988                                 

Gene name
bglB
Definition
putative cryptic beta-glucosidase/phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lmq  Listeria monocytogenes M7
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMM7_0349 (bglB)
Enzymes [BR:lmq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LMM7_0349 (bglB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(365131..366546)
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFGHITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPLT
SNPDDIIAVMEAERKNYFFSDVHVRGTYPGYMKRYFRENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGWQIDPQGLRVVLNEFWDRYQK
PLFIVENGLGAIDQLEKDENGNYTVNDDYRINYLSAHLSQVKEAIKDGVDLMGYTSWGCI
DLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFDWYKNVIATNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacaggatttccagccgactttttatggggtggagctgctgctgcaaac
caattcgaaggcgcttacaacgtcgatggaaaaggactttccgttcaagatgttactcca
aaaggcggattcggtcacattactgacggtccaacaccagataacttaaaattagaagga
attgacttctatcatcgctacaaagatgacgtgaaactttttgccgaaatgggcttcaag
gttttccgtacttccatcgcttggtcccgtatctttccaaatggtgacgaaactgagcca
aacgaagcaggactacaattttacgatgatttattcgacgaacttctagcacataatatc
gaaccactgattactttatctcactatgaaacaccacttcatttatcgaaaacttacgac
ggatgggtaaatagaaaaatgatcgatttctatgaaaactatgtccgcaccgtatttaat
cgctataaaggcaaagtaaaatattggctaacattcaatgaaatcaactccattttacac
gcaccattcatgagcggcggtatttctacaagcccagataaattatcacaaaaagactta
taccaagctgtccaccacgaacttgtggcgagcgcgctggctacaaaaattggtcacgaa
atcatgcccgaagctcaaatcggctgcatggtccttgcaatgccaacttatccgctaact
tccaacccagatgatattatcgctgttatggaagcagagcgcaaaaactacttcttctcc
gatgtccatgtccgcggaacttatccgggctacatgaaacgctatttcagagaaaataat
attgaattagacgtaacagaagaagacctagaaatccttaaaaacacagtagatttcatt
tccttcagctattacatgagcacaaccgaaacagctgacgagtcgaaacgcaaagctggc
gcaggaaacatcctaggcggcgtacaaaacccatacctagaagcatctgaatggggctgg
caaatcgaccctcaaggtttacgcgttgtcctaaacgaattctgggatagataccaaaaa
ccacttttcatcgtagaaaacggtcttggcgctatcgatcaactagaaaaagacgaaaat
ggcaactacacagtaaatgacgactatcgtattaattatttgagcgctcatttatcgcaa
gtgaaagaagcgattaaagatggcgttgacttgatgggttacacttcatggggctgtatt
gacctagtaagtgcctccactgctgaaatgaagaaacgttacggctttatctatgtcgat
cgcaacaacgacggcacaggtacgctaaaccgttataagaagaaaagttttgattggtac
aagaacgttattgctaccaatggtgaagatttataa

DBGET integrated database retrieval system