KEGG   Listeria monocytogenes M7: LMM7_0859Help
Entry
LMM7_0859         CDS       T01988                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lmq  Listeria monocytogenes M7
Pathway
lmq00010  Glycolysis / Gluconeogenesis
lmq00030  Pentose phosphate pathway
lmq00051  Fructose and mannose metabolism
lmq00680  Methane metabolism
lmq01100  Metabolic pathways
lmq01110  Biosynthesis of secondary metabolites
lmq01120  Microbial metabolism in diverse environments
lmq01130  Biosynthesis of antibiotics
lmq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMM7_0859 (fbp)
   00030 Pentose phosphate pathway
    LMM7_0859 (fbp)
   00051 Fructose and mannose metabolism
    LMM7_0859 (fbp)
  Energy metabolism
   00680 Methane metabolism
    LMM7_0859 (fbp)
Enzymes [BR:lmq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LMM7_0859 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos
Motif
Other DBs
NCBI-ProteinID: AEH91864
UniProt: A0A0E0UU67
Position
complement(860304..862268)
Genome map
AA seq 654 aa AA seqDB search
MVNTLDMKYLHLLAKEYPTIAKTATEIINLEAIMNLPKGTEHFLSDVHGEYSAFEQVLRN
GSGVVKRKIRDIFGAELDDAEINSLSTLIYYPEEKMDLIASETEDLHAWYRTTLFRLIEL
CQYVASKYTRSKVRKAMPEDFAYILEELLHENYNEDDKKLYYEEILQHIISLGRAEEFIS
ALSRLIQQLVVDHLHIVGDVYDRGPYPDKIMDTLMNYHSLDFQWGNHDILWMGAASGSRV
CAANVIRISARYLNLDILEDSYGISLRPLALFADEVYKDDPCKYFQPKNEDNTDYSNAEI
TQIARMHKAISIIQFKLEGEIINRRKEFNMEHRLLLQFIDYKKGTIQLKGKTYQLLDTHF
PTIDPENPYTLTDGEKDLIEKITASFKNCRRLQKHVQFLYSKGSMFLTYNGNLLYHGCIP
LHEDGTFMEMKLRGEKYAGRALLEQFEILTREAYVRPPGTKEKKYACDIVWYLWTGAISS
LFGKSEMTTFERYFVAEKETHKEEKNPYYKLRNDEFICKQILEEFGLDGECGHIINGHTP
VKEGKGESPIKASGKMLVIDGGFAKAYHKETSLAGYTLLFNSYGLQLVSHQPFTTKEDAI
KNETDILSTRQVIEMEINRKRVRDTDIGAKLSEQAEDLKVLLDAYRNGLLHENR
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
gtggtgaatactttagatatgaaatatttgcatttattagcaaaagaatatcccactatc
gctaaaacagctacggaaatcattaatctggaagcaattatgaatcttcccaaaggaacc
gaacattttttaagtgatgttcacggggaatatagtgcttttgaacaagtgcttcgtaac
ggttctggtgttgtaaaacgaaaaattcgtgatatttttggagcagaattagatgatgcg
gagattaattcactaagtacgctgatttattatccggaagaaaagatggatttgattgct
agtgagacggaagatttgcatgcttggtaccgcactacgctctttcgcttaattgaacta
tgtcaatatgtcgcttctaaatacacgcggtccaaagttagaaaagccatgccggaagat
tttgcctacatattagaagagttgcttcatgaaaactacaatgaagatgacaaaaaactt
tactatgaagaaattttacaacatattatttcacttggtcgtgcagaagaatttattagt
gctctctcgcgtcttattcaacaattggttgtagatcacctgcatattgttggtgatgtt
tacgatcgcggtccttatccagataaaatcatggatactttgatgaattatcattcactc
gatttccagtggggcaatcatgatattttatggatgggagcagctagtggttctagagtt
tgtgcagctaatgttattcggatctctgcccgttatttaaatttagatattttagaagat
agttacggcatctcccttcgccctcttgccctgtttgcggatgaagtgtataaagatgac
ccttgtaaatacttccaaccaaaaaatgaagataatacggactatagtaacgcagaaatc
acacaaatagctagaatgcacaaagccatctcgattattcagtttaaattagagggcgaa
attattaatcgtcgtaaagaatttaatatggagcatcggctattacttcaatttatcgat
tataaaaaaggcaccattcagctaaaaggaaaaacttaccagcttctagacacacatttc
ccaacgattgatccagaaaatccctacactcttaccgatggagagaaagatcttatcgaa
aaaattactgcctcttttaaaaattgtcgtcgcttgcaaaagcatgtgcaatttttatat
tcgaaagggagcatgtttttaacttataacggcaatttgttgtaccatggctgcattccg
cttcatgaagatgggacttttatggaaatgaaattgcgcggggagaaatatgccggtcgc
gcacttttagagcaatttgaaatactaactcgtgaagcatacgtccgcccaccaggaaca
aaagaaaagaaatatgcgtgtgatatcgtttggtatttatggactggtgccatttcttca
ctctttggaaaaagtgaaatgactacctttgaacgctattttgttgctgaaaaagaaaca
cacaaagaggaaaaaaatccttattataaattacgcaacgatgaattcatttgtaagcaa
attttggaagaatttggtcttgatggggaatgtggacatattattaacggccatacaccc
gtcaaagaaggcaaaggagaaagtcccattaaagcgagtggcaaaatgctcgtgattgat
ggcggatttgctaaagcctatcacaaagaaacgagcttggctggatatacgttacttttc
aacagttacggtttacaattagtcagtcatcaaccctttactacgaaagaagacgcgatt
aaaaatgaaacggacattctttccactcgacaagttatcgaaatggaaattaaccgtaaa
cgagtaagagatacggacattggtgcgaaactaagtgagcaagcagaagatttaaaagtg
ctgctagatgcttaccgtaatggtttgctacatgaaaatcgttag

DBGET integrated database retrieval system