KEGG   Listeria monocytogenes M7: LMM7_0917Help
Entry
LMM7_0917         CDS       T01988                                 

Gene name
hemG
Definition
putative protoporphyrinogen IX/coproporphyrinogen III oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lmq  Listeria monocytogenes M7
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lmq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LMM7_0917 (hemG)
Enzymes [BR:lmq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     LMM7_0917 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
917962..919341
Genome map
AA seq 459 aa AA seqDB search
MKHIVIIGGGLSGLAAAYELQKTHPNYTWELVEKDEKLGGKFETVKRDGFLIEKGPDSFL
ARKPAGVGLVKDLGLEDKLIANATGRSYIYHQKALHPIPEGSVMGIPTDKEALLASTLVS
EIGKARALQEPTMERNNQEQDQALGDFFEARFGKELVKTIIEPLLSGIYAGDIYKMSLRA
TFPQFEQTVKKYGNLMDGLKESSMQTTGTKATIGAFRTLEGGLDTLPKAIAAALPKGNLH
TAKQATNITKKNSSYEISFADGDKMEADGVIIAATHDALIHLLAEKTTEPFAGQPLTTLA
TVSLAYNEQDVPILPDGTGYLVARTAPYKTTACTWVQKKWPHMVPKNKMLLRGFVGKAGE
TWLEQASDEAIVSAVLTDYAEIMDLHAAPLFYEVSRMKSAMPQYLVNHQDRLKQLKKNVK
ADYPGVYFAGMSYEGVGIPDCIAGAQTAINELAEYLEEV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatatagtcattatcggaggcggcttatcagggctcgcagcagcgtatgaacta
caaaaaacacatccgaattatacttgggaattagtagaaaaagacgaaaaactaggcgga
aaatttgaaacggtcaaacgggacggatttttaattgaaaaaggaccagactccttttta
gcaagaaaaccagctggtgtaggcttagtgaaggatttaggactcgaagataaactgatt
gcgaatgcgaccggaagatcctatatttatcatcaaaaagcgcttcatccgattccagaa
ggctctgtgatgggaattccgacagacaaagaagcgctgctagcaagcacactcgtatcg
gaaattggcaaagcacgagcacttcaagaaccaacaatggaacggaataatcaagaacaa
gatcaagcacttggcgatttctttgaagcgcgattcggtaaagaattagtcaaaacaatt
atcgaaccacttttatcaggaatttatgccggggatatatacaaaatgagtttacgcgcc
acttttccacaattcgaacaaacggttaaaaaatatggaaatttgatggatggtttgaaa
gaaagtagcatgcaaacgactggtacaaaagcaactattggcgcttttcgaacattagaa
ggcgggctagacactttaccaaaagccattgcggccgcacttccaaaaggaaatttgcat
acagcaaaacaagcaaccaacattacgaaaaagaatagctcttacgaaatctcgtttgca
gatggcgataaaatggaagcagatggcgtcattattgctgccacacatgatgcgttaatt
catttgttagctgaaaaaacgacagaaccattcgcgggacaaccgcttacgactctcgca
actgtctcattagcatacaatgaacaagatgtaccgattttaccagacgggacgggctac
ttagttgccagaaccgcgccgtataaaactactgcctgtacttgggtgcagaaaaaatgg
ccgcatatggtgccaaagaataaaatgttactacgaggctttgtcggaaaagcaggggaa
acttggttagagcaagcaagcgatgaagcaatcgtctctgctgttttgacagattatgcg
gaaattatggaccttcacgccgcgccgcttttttatgaagtaagccgaatgaaatccgcg
atgccacaatacttagtcaatcaccaagataggctaaaacaattgaaaaagaacgtcaag
gcagattacccaggtgtctattttgcaggaatgagttacgaaggtgtgggtattcctgat
tgcatcgctggggcacaaacagccattaatgaattagcagaatacttggaagaggtgtaa

DBGET integrated database retrieval system